Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-Galnt11 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Rat Heart)

Rabbit Galnt11 Polyclonal Antibody | anti-GALNT11 antibody

Galnt11 antibody - N-terminal region

Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Galnt11; Polyclonal Antibody; Galnt11 antibody - N-terminal region; anti-GALNT11 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LGMIFNERDQELRDLGYQKHAFNMLISNRLGYHRDVPDTRNAECRRKSYP
Sequence Length
608
Applicable Applications for anti-GALNT11 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide corresponding to a region of Rat
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-Galnt11 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Rat Heart)

Western Blot (WB) (WB Suggested Anti-Galnt11 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Rat Heart)
Related Product Information for anti-GALNT11 antibody
This is a rabbit polyclonal antibody against Galnt11. It was validated on Western Blot

Target Description: The function of Galnt11 remains unknown.
Product Categories/Family for anti-GALNT11 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
69kDa
NCBI Official Full Name
polypeptide N-acetylgalactosaminyltransferase 11
NCBI Official Synonym Full Names
polypeptide N-acetylgalactosaminyltransferase 11
NCBI Official Symbol
Galnt11
NCBI Protein Information
polypeptide N-acetylgalactosaminyltransferase 11
UniProt Protein Name
Polypeptide N-acetylgalactosaminyltransferase 11
UniProt Gene Name
Galnt11
UniProt Synonym Gene Names
GalNAc-T11; pp-GaNTase 11
UniProt Entry Name
GLT11_MOUSE

NCBI Description

mouse homolog is a member of the UDP-GalNAc:polypeptide N acetylgalactosaminyltransferase (ppGaNTase) family, which transfers GalNAc to serine and threonine sites and plays a role in mucin-type O-glycosylation [RGD, Feb 2006]

Uniprot Description

GALNT11: Catalyzes the initial reaction in O-linked oligosaccharide biosynthesis, the transfer of an N-acetyl-D- galactosamine residue to a serine or threonine residue on the protein receptor. Displays the same enzyme activity toward Muc1, Muc4.1, and EA2 than GALNT1. Does not appear to be involved in glycosylation of erythropoietin. Belongs to the glycosyltransferase 2 family. GalNAc-T subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Glycan Metabolism - O-glycan biosynthesis; EC 2.4.1.41; Transferase; Membrane protein, integral

Cellular Component: Golgi apparatus; membrane; integral to membrane

Molecular Function: transferase activity; transferase activity, transferring glycosyl groups; polypeptide N-acetylgalactosaminyltransferase activity; metal ion binding; carbohydrate binding; Notch binding

Biological Process: Notch signaling pathway; protein amino acid O-linked glycosylation via threonine

Similar Products

Product Notes

The GALNT11 galnt11 (Catalog #AAA3209572) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Galnt11 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Galnt11 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GALNT11 galnt11 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LGMIFNERDQ ELRDLGYQKH AFNMLISNRL GYHRDVPDTR NAECRRKSYP. It is sometimes possible for the material contained within the vial of "Galnt11, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.