Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-GALNT10 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Liver)

Rabbit GALNT10 Polyclonal Antibody | anti-GALNT10 antibody

GALNT10 antibody - N-terminal region

Gene Names
GALNT10; GALNACT10; PPGALNACT10; PPGANTASE10
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
GALNT10; Polyclonal Antibody; GALNT10 antibody - N-terminal region; anti-GALNT10 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VPAGVSLARNLKRVAEVWMDEYAEYIYQRRPEYRHLSAGDVAVQKKLRSS
Sequence Length
274
Applicable Applications for anti-GALNT10 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human GALNT10
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-GALNT10 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Liver)

Western Blot (WB) (WB Suggested Anti-GALNT10 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Liver)
Related Product Information for anti-GALNT10 antibody
This is a rabbit polyclonal antibody against GALNT10. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: GALNT10 belongs to the polypeptide N-acetylgalactosaminyltransferase (pp-GalNAc-T) family. Polypeptide GalNAc transferases initiate the synthesis of mucin-type oligosaccharides by transferring GalNAc from UDP-GalNAc to the hydroxyl group of either a serine or threonine residue on the polypeptide acceptor. Following expression in insect cells, recombinant GalNAc transferase 10 showed significant GalNAcT activity toward mucin-derived peptides, and it utilized both nonglycosylated and glycosylated peptide substrates.This gene belongs to the polypeptide N-acetylgalactosaminyltransferase (pp-GalNAc-T) gene family. Polypeptide GalNAc transferases initiate the synthesis of mucin-type oligosaccharides by transferring GalNAc from UDP-GalNAc to the hydroxyl group of either a serine or threonine residue on the polypeptide acceptor. Following expression in insect cells, recombinant GalNAc transferase 10 showed significant GalNAcT activity toward mucin-derived peptides, and it utilized both nonglycosylated and glycosylated peptide substrates. Two transcript variants encoding distinct isoforms have been identified for this gene.
Product Categories/Family for anti-GALNT10 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
31kDa
NCBI Official Full Name
polypeptide N-acetylgalactosaminyltransferase 10
NCBI Official Synonym Full Names
polypeptide N-acetylgalactosaminyltransferase 10
NCBI Official Symbol
GALNT10
NCBI Official Synonym Symbols
GALNACT10; PPGALNACT10; PPGANTASE10
NCBI Protein Information
polypeptide N-acetylgalactosaminyltransferase 10
UniProt Protein Name
Polypeptide N-acetylgalactosaminyltransferase 10
UniProt Gene Name
GALNT10
UniProt Synonym Gene Names
GalNAc-T10; pp-GaNTase 10
UniProt Entry Name
GLT10_HUMAN

NCBI Description

This gene encodes a member of the GalNAc polypeptide N-acetylgalactosaminyltransferases. These enzymes catalyze the first step in the synthesis of mucin-type oligosaccharides. These proteins transfer GalNAc from UDP-GalNAc to either serine or threonine residues of polypeptide acceptors. The protein encoded by this locus may have increased catalytic activity toward glycosylated peptides compared to activity toward non-glycosylated peptides.[provided by RefSeq, Apr 2010]

Uniprot Description

GALNT10: Catalyzes the initial reaction in O-linked oligosaccharide biosynthesis, the transfer of an N-acetyl-D- galactosamine residue to a serine or threonine residue on the protein receptor. Has activity toward Muc5Ac and EA2 peptide substrates. Belongs to the glycosyltransferase 2 family. GalNAc-T subfamily. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Transferase; Glycan Metabolism - O-glycan biosynthesis; EC 2.4.1.41

Chromosomal Location of Human Ortholog: 5q33.2

Cellular Component: Golgi membrane; integral to membrane

Molecular Function: metal ion binding; polypeptide N-acetylgalactosaminyltransferase activity; carbohydrate binding

Biological Process: protein amino acid O-linked glycosylation; cellular protein metabolic process; O-glycan processing; post-translational protein modification

Research Articles on GALNT10

Similar Products

Product Notes

The GALNT10 galnt10 (Catalog #AAA3209174) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GALNT10 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's GALNT10 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GALNT10 galnt10 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VPAGVSLARN LKRVAEVWMD EYAEYIYQRR PEYRHLSAGD VAVQKKLRSS. It is sometimes possible for the material contained within the vial of "GALNT10, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.