Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit anti-Human, Mouse Galectin-3 Polyclonal Antibody | anti-GAL3 antibody

Galectin-3 (GAL3, Carbohydrate Binding Protein 35, CBP35, Galactose Specific Lectin 3, Galactoside Binding Protein, GALBP, IgE Binding Protein, Laminin Binding Protein, Lectin Galactose Binding Soluble 3, LGALS3, MAC2) (MaxLight 550)

Gene Names
LGALS3; L31; GAL3; MAC2; CBP35; GALBP; GALIG; LGALS2
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Galectin-3; Polyclonal Antibody; Galectin-3 (GAL3; Carbohydrate Binding Protein 35; CBP35; Galactose Specific Lectin 3; Galactoside Binding Protein; GALBP; IgE Binding Protein; Laminin Binding Protein; Lectin Galactose Binding Soluble 3; LGALS3; MAC2) (MaxLight 550); anti-GAL3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human LGALS3. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.
Sequence Length
250
Applicable Applications for anti-GAL3 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human LGALS3, aa1-250 (AAH53667.1).
Immunogen Sequence
MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYHGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSAPGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI
Conjugate
MaxLight550
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-GAL3 antibody
Lectins are carbohydrate binding proteins that interact with glycoprotein and glycolipids on the surface of animal cells. The Galectins are lectins that recognize and interact with betagalactoside moieties. Galactin-3 regulates a number of biological processes, including embryogenesis, inflammatory responses, cell progression and metastasis. Galectin-3 can function intracellularly in controlling cell cycle and preventing T-cell apoptosis, and also extracellularly, in activating various cells, including monocytes/macrophages, mast cells, neutrophils, and lymphocytes. Human Galectin-3 is a globular 26kD protein containing 250aa residues.
Product Categories/Family for anti-GAL3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Lectin, galactoside-binding, soluble, 3
NCBI Official Synonym Full Names
galectin 3
NCBI Official Symbol
LGALS3
NCBI Official Synonym Symbols
L31; GAL3; MAC2; CBP35; GALBP; GALIG; LGALS2
NCBI Protein Information
galectin-3
UniProt Protein Name
Galectin-3
Protein Family
UniProt Gene Name
LGALS3
UniProt Synonym Gene Names
MAC2; Gal-3; CBP 35; GALBP
UniProt Entry Name
LEG3_HUMAN

NCBI Description

This gene encodes a member of the galectin family of carbohydrate binding proteins. Members of this protein family have an affinity for beta-galactosides. The encoded protein is characterized by an N-terminal proline-rich tandem repeat domain and a single C-terminal carbohydrate recognition domain. This protein can self-associate through the N-terminal domain allowing it to bind to multivalent saccharide ligands. This protein localizes to the extracellular matrix, the cytoplasm and the nucleus. This protein plays a role in numerous cellular functions including apoptosis, innate immunity, cell adhesion and T-cell regulation. The protein exhibits antimicrobial activity against bacteria and fungi. Alternate splicing results in multiple transcript variants.[provided by RefSeq, Oct 2014]

Uniprot Description

Galectin-3: galactose-specific lectin which binds IgE. Expressed at a high level in the colonic epithelium. Also abundant in activated macrophages.

Protein type: Cell surface; Motility/polarity/chemotaxis; Extracellular matrix

Chromosomal Location of Human Ortholog: 14q22.3

Cellular Component: extracellular matrix; spliceosome; extracellular space; proteinaceous extracellular matrix; membrane; mitochondrial inner membrane; cytoplasm; plasma membrane; immunological synapse; nucleus; external side of plasma membrane

Molecular Function: protein binding; laminin binding; IgE binding; carbohydrate binding; chemoattractant activity

Biological Process: monocyte chemotaxis; neutrophil chemotaxis; extracellular matrix organization and biogenesis; epithelial cell differentiation; positive chemotaxis; RNA splicing; negative regulation of endocytosis; regulation of T cell proliferation; eosinophil chemotaxis; negative regulation of T cell receptor signaling pathway; innate immune response; mRNA processing; skeletal development; macrophage chemotaxis

Research Articles on GAL3

Similar Products

Product Notes

The GAL3 lgals3 (Catalog #AAA6379270) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Galectin-3 (GAL3, Carbohydrate Binding Protein 35, CBP35, Galactose Specific Lectin 3, Galactoside Binding Protein, GALBP, IgE Binding Protein, Laminin Binding Protein, Lectin Galactose Binding Soluble 3, LGALS3, MAC2) (MaxLight 550) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's Galectin-3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GAL3 lgals3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Galectin-3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.