Rabbit anti-Human, Mouse Galectin-3 Polyclonal Antibody | anti-GAL3 antibody

Galectin-3 (GAL3, Carbohydrate Binding Protein 35, CBP35, Galactose Specific Lectin 3, Galactoside Binding Protein, GALBP, IgE Binding Protein, Laminin Binding Protein, Lectin Galactose Binding Soluble 3, LGALS3, MAC2) (AP)

Cat. Num. AAA6379263

• Gene Names: LGALS3; L31; GAL3; MAC2; CBP35; GALBP; GALIG; LGALS2
• Reactivity: Human, Mouse
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: Galectin-3; Polyclonal Antibody; Galectin-3 (GAL3; Carbohydrate Binding Protein 35; CBP35; Galactose Specific Lectin 3; Galactoside Binding Protein; GALBP; IgE Binding Protein; Laminin Binding Protein; Lectin Galactose Binding Soluble 3; LGALS3; MAC2) (AP); anti-GAL3 antibody

• Host: Rabbit
• Reactivity: Human, Mouse
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human LGALS3. Species Crossreactivity: mouse.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
• Sequence Length: 250

• Applicable Applications for anti-GAL3 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human LGALS3, aa1-250 (AAH53667.1).
• Immunogen Sequence: MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYHGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSAPGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI
• Conjugate: AP
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(LGALS3 rabbit polyclonal antibody. Western Blot analysis of LGALS3 expression in human colon.)

Western Blot (WB)

(LGALS3 rabbit polyclonal antibody. Western Blot analysis of LGALS3 expression in Hela NE.)

Western Blot (WB)

(Western Blot analysis of LGALS3 expression in transfected 293T cell line by LGALS3 polyclonal antibody. Lane 1: LGALS3 transfected lysate (26.2kD). Lane 2: Non-transfected lysate.)

Western Blot (WB)

(LGALS3 rabbit polyclonal antibody. Western Blot analysis of LGALS3 expression in human stomach.)

Related Product Information for anti-GAL3 antibody

Lectins are carbohydrate binding proteins that interact with glycoprotein and glycolipids on the surface of animal cells. The Galectins are lectins that recognize and interact with betagalactoside moieties. Galactin-3 regulates a number of biological processes, including embryogenesis, inflammatory responses, cell progression and metastasis. Galectin-3 can function intracellularly in controlling cell cycle and preventing T-cell apoptosis, and also extracellularly, in activating various cells, including monocytes/macrophages, mast cells, neutrophils, and lymphocytes. Human Galectin-3 is a globular 26kD protein containing 250aa residues.

Product Categories/Family for anti-GAL3 antibody

Antibodies; Lamin; Laminin

NCBI and Uniprot Product Information

• NCBI GI #: 31657226
• NCBI GeneID: 3958
• NCBI Accession #: AAH53667.1
• NCBI GenBank Nucleotide #: NM_002306.1
• UniProt Accession #: P17931
• NCBI Official Full Name: Lectin, galactoside-binding, soluble, 3
• NCBI Official Synonym Full Names: galectin 3
• NCBI Official Symbol: LGALS3
• NCBI Official Synonym Symbols: L31; GAL3; MAC2; CBP35; GALBP; GALIG; LGALS2
• NCBI Protein Information: galectin-3
• UniProt Protein Name: Galectin-3
• Protein Family: Galectin
• UniProt Gene Name: LGALS3
• UniProt Synonym Gene Names: MAC2; Gal-3; CBP 35; GALBP
• UniProt Entry Name: LEG3_HUMAN

NCBI Description

This gene encodes a member of the galectin family of carbohydrate binding proteins. Members of this protein family have an affinity for beta-galactosides. The encoded protein is characterized by an N-terminal proline-rich tandem repeat domain and a single C-terminal carbohydrate recognition domain. This protein can self-associate through the N-terminal domain allowing it to bind to multivalent saccharide ligands. This protein localizes to the extracellular matrix, the cytoplasm and the nucleus. This protein plays a role in numerous cellular functions including apoptosis, innate immunity, cell adhesion and T-cell regulation. The protein exhibits antimicrobial activity against bacteria and fungi. Alternate splicing results in multiple transcript variants.[provided by RefSeq, Oct 2014]

Uniprot Description

Galectin-3: galactose-specific lectin which binds IgE. Expressed at a high level in the colonic epithelium. Also abundant in activated macrophages.

Protein type: Cell surface; Motility/polarity/chemotaxis; Extracellular matrix

Chromosomal Location of Human Ortholog: 14q22.3

Cellular Component: extracellular matrix; spliceosome; extracellular space; proteinaceous extracellular matrix; membrane; mitochondrial inner membrane; cytoplasm; plasma membrane; immunological synapse; nucleus; external side of plasma membrane

Molecular Function: protein binding; laminin binding; IgE binding; carbohydrate binding; chemoattractant activity

Biological Process: monocyte chemotaxis; neutrophil chemotaxis; extracellular matrix organization and biogenesis; epithelial cell differentiation; positive chemotaxis; RNA splicing; negative regulation of endocytosis; regulation of T cell proliferation; eosinophil chemotaxis; negative regulation of T cell receptor signaling pathway; innate immune response; mRNA processing; skeletal development; macrophage chemotaxis