Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-GABRB1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Small Intestine)

Rabbit GABRB1 Polyclonal Antibody | anti-GABRB1 antibody

GABRB1 antibody - N-terminal region

Gene Names
GABRB1; EIEE45
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
GABRB1; Polyclonal Antibody; GABRB1 antibody - N-terminal region; anti-GABRB1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRIT
Sequence Length
474
Applicable Applications for anti-GABRB1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human GABRB1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-GABRB1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Small Intestine)

Western Blot (WB) (WB Suggested Anti-GABRB1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Small Intestine)
Related Product Information for anti-GABRB1 antibody
This is a rabbit polyclonal antibody against GABRB1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: GABA, the major inhibitory neurotransmitter in the vertebrate brain, mediates neuronal inhibition by binding to the GABA/benzodiazepine receptor and opening an integral chloride channel.The gamma-aminobutyric acid (GABA) A receptor is a multisubunit chloride channel that mediates the fastest inhibitory synaptic transmission in the central nervous system. This gene encodes GABA A receptor, beta 1 subunit. It is mapped to chromosome 4p12 in a cluster comprised of genes encoding alpha 4, alpha 2 and gamma 1 subunits of the GABA A receptor. Alteration of this gene is implicated in the pathogenetics of schizophrenia. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Product Categories/Family for anti-GABRB1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
51kDa
NCBI Official Full Name
gamma-aminobutyric acid receptor subunit beta-1
NCBI Official Synonym Full Names
gamma-aminobutyric acid type A receptor beta1 subunit
NCBI Official Symbol
GABRB1
NCBI Official Synonym Symbols
EIEE45
NCBI Protein Information
gamma-aminobutyric acid receptor subunit beta-1
UniProt Protein Name
Gamma-aminobutyric acid receptor subunit beta-1
UniProt Gene Name
GABRB1
UniProt Entry Name
GBRB1_HUMAN

NCBI Description

The gamma-aminobutyric acid (GABA) A receptor is a multisubunit chloride channel that mediates the fastest inhibitory synaptic transmission in the central nervous system. This gene encodes GABA A receptor, beta 1 subunit. It is mapped to chromosome 4p12 in a cluster comprised of genes encoding alpha 4, alpha 2 and gamma 1 subunits of the GABA A receptor. Alteration of this gene is implicated in the pathogenetics of schizophrenia. [provided by RefSeq, Jul 2008]

Uniprot Description

GABRB1: GABA, the major inhibitory neurotransmitter in the vertebrate brain, mediates neuronal inhibition by binding to the GABA/benzodiazepine receptor and opening an integral chloride channel. Belongs to the ligand-gated ion channel (TC 1.A.9) family. Gamma-aminobutyric acid receptor (TC 1.A.9.5) subfamily. GABRB1 sub-subfamily.

Protein type: Channel, chloride; Membrane protein, multi-pass; Membrane protein, integral; Transporter; Transporter, ion channel; Channel, ligand-gated

Chromosomal Location of Human Ortholog: 4p12

Cellular Component: postsynaptic membrane; integral to plasma membrane; plasma membrane; cell junction

Molecular Function: chloride channel activity; GABA-A receptor activity; ligand-gated ion channel activity; extracellular ligand-gated ion channel activity

Biological Process: synaptic transmission; transport; ion transport; signal transduction; transmembrane transport

Research Articles on GABRB1

Similar Products

Product Notes

The GABRB1 gabrb1 (Catalog #AAA3202393) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GABRB1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's GABRB1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GABRB1 gabrb1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TLDNRVADQL WVPDTYFLND KKSFVHGVTV KNRMIRLHPD GTVLYGLRIT. It is sometimes possible for the material contained within the vial of "GABRB1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.