Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-Gabarapl2 AntibodyTitration: 1.0 ug/mlPositive Control: Rat Brain)

Rabbit Gabarapl2 Polyclonal Antibody | anti-GABARAPL2 antibody

Gabarapl2 antibody - C-terminal region

Gene Names
Gabarapl2; Gef2
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Gabarapl2; Polyclonal Antibody; Gabarapl2 antibody - C-terminal region; anti-GABARAPL2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGENTF
Sequence Length
117
Applicable Applications for anti-GABARAPL2 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide corresponding to a region of Rat
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-Gabarapl2 AntibodyTitration: 1.0 ug/mlPositive Control: Rat Brain)

Western Blot (WB) (WB Suggested Anti-Gabarapl2 AntibodyTitration: 1.0 ug/mlPositive Control: Rat Brain)
Related Product Information for anti-GABARAPL2 antibody
This is a rabbit polyclonal antibody against Gabarapl2. It was validated on Western Blot

Target Description: As a mouse homolog, Gabarapl2 may function as a soluble transport factor and/or a GABA(A) receptor linker.
Product Categories/Family for anti-GABARAPL2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
14kDa
NCBI Official Full Name
gamma-aminobutyric acid receptor-associated protein-like 2
NCBI Official Synonym Full Names
GABA type A receptor associated protein like 2
NCBI Official Symbol
Gabarapl2
NCBI Official Synonym Symbols
Gef2
NCBI Protein Information
gamma-aminobutyric acid receptor-associated protein-like 2
UniProt Protein Name
Gamma-aminobutyric acid receptor-associated protein-like 2
UniProt Gene Name
Gabarapl2
UniProt Synonym Gene Names
Gef2; GEF-2; GATE-16
UniProt Entry Name
GBRL2_RAT

NCBI Description

mouse homolog may function as a soluble transport factor and/or a GABA(A) receptor linker [RGD, Feb 2006]

Uniprot Description

GABARAPL2: is a ubiquitin-like protein that is a constituent of the ATG8-conjugation system, one of two evolutionarily conserved phosphatidylethanolamine conjugation systems necessary for the formation of the autophagosome. The human ATG8 system includes seven ubiquitin-like light chain proteins (LCPs) that are homologs of yeast LC3: MAP1LC3A, -B, -C, GABARAP, GABARAPL1, -2, and -3. Pro-LCPs are cleaved by ATG4B to expose a C-terminal glycine residue, the cytosolic LCP-I form. The exposed C-terminus is conjugated to the head group amine of phosphatidylethanolamine (PE) through an amide bond by a sequence of ubiquitination-like reactions that involves an E1 (ATG7), an E2 (ATG3), and an E3 (a complex including ATG5, ATG12, and ATG16L). The PE-congugated form (LCP-II) is tightly associated with the autophagosomal membrane. The LCP-II forms can also be delipidated by the ATG4 proteases: most of the LCPs are delipidated and liberated from the membrane before autophagosomes fuse with lysosomes. Implicated in intra-Golgi transport and post-mitotic Golgi re-assembly. Modulates the activity of SNAREs in the Golgi apparatus and is therefore an essential component of intra-Golgi transport and post-mitotic Golgi re-assembly. It first stimulates the ATPase activity of NSF, which in turn stimulates the association with GOSR1. Interacts with GABRG2, NSF, GOSR1 and beta-tubulin. Interacts with ULK1. Phosphorylated upon DNA damage, probably by ATM or ATR.

Protein type: Adaptor/scaffold; Autophagy; Microtubule-binding; Ubiquitin-like modifier; Vesicle

Cellular Component: autophagic vacuole; cytoplasm; cytosol; Golgi apparatus; Golgi membrane; intracellular

Molecular Function: ubiquitin protein ligase binding

Biological Process: autophagic vacuole formation; cellular response to nitrogen starvation; mitochondrion degradation

Similar Products

Product Notes

The GABARAPL2 gabarapl2 (Catalog #AAA3210735) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Gabarapl2 antibody - C-terminal region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's Gabarapl2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GABARAPL2 gabarapl2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KRIQLPSEKA IFLFVDKTVP QSSLTMGQLY EKEKDEDGFL YVAYSGENTF. It is sometimes possible for the material contained within the vial of "Gabarapl2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.