Rabbit anti-Human, Mouse GAB2 Polyclonal Antibody | anti-GAB2 antibody

GAB2 Polyclonal Antibody

Cat. Num. AAA9133115

• Reactivity: Human, Mouse
• Applications: Western Blot
• Purity: Affinity Purification
• Synonyms: GAB2; Polyclonal Antibody; GAB2 Polyclonal Antibody; anti-GAB2 antibody

• Host: Rabbit
• Reactivity: Human, Mouse
• Clonality: Polyclonal
• Isotype: IgG
• Purity/Purification: Affinity Purification
• Sequence: ENSRSVAATIPRRNTLPAMDNSRLHRASSCETYEYPQRGGESAGRSAESMSDGVGSFLPGKMIVGRSDSTNSEDNYVPMNPGSSTLLAMERAGDNSQSVYIPMSPGAHHFDSLGYPSTTLPVHRGPSRGSEIQPPPVNRNLKPDRKAKPTPLDLRNNTVIDELPFKSPITKSWSRANHTFNSSSSQYCRPISTQSITSTDSGDSEENYVPMQNPVSASPVPSGTNSPAPKKSTGSVDYLALDFQPSSPSPHRKPS
• Sequence Length: 638

• Applicable Applications for anti-GAB2 antibody: Western Blot (WB)
• Application Notes: WB: 1:500 - 1:2000
• Immunogen: Recombinant protein of human GAB2
• Immunogen Species: Human
• Storage Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
• Cellular Location: Cell membrane, Cytoplasm
• Positive Samples: HeLa, Mouse kidney
• Preparation and Storage: Store at -20 degree C. Avoid freeze / thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of various cell lines, using GAB2 antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit.Exposure time: 90s.)

Related Product Information for anti-GAB2 antibody

This gene is a member of the GRB2-associated binding protein (GAB) gene family. These proteins contain pleckstrin homology (PH) domain, and bind SHP2 tyrosine phosphatase and GRB2 adapter protein. They act as adapters for transmitting various signals in response to stimuli through cytokine and growth factor receptors, and T- and B-cell antigen receptors. The protein encoded by this gene is the principal activator of phosphatidylinositol-3 kinase in response to activation of the high affinity IgE receptor. Two alternatively spliced transcripts encoding different isoforms have been described for this gene.

Product Categories/Family for anti-GAB2 antibody

Polyclonal Antibodies

NCBI and Uniprot Product Information

• NCBI GI #: 6912460
• NCBI GeneID: 9846
• NCBI Accession #: NP_036428.1
• NCBI GenBank Nucleotide #: NM_012296.3
• UniProt Accession #: Q9UQC2; O60317; A2RRM2; A6NEW9; A7MD36
• Molecular Weight: Calculated: 69kDa; 74kDa; Observed: 74kDa
• NCBI Official Full Name: GRB2-associated-binding protein 2 isoform b
• NCBI Official Synonym Full Names: GRB2 associated binding protein 2
• NCBI Official Symbol: GAB2
• NCBI Protein Information: GRB2-associated-binding protein 2
• UniProt Protein Name: GRB2-associated-binding protein 2
• Protein Family: GRB2-associated-binding protein
• UniProt Gene Name: GAB2
• UniProt Synonym Gene Names: KIAA0571

NCBI Description

This gene is a member of the GRB2-associated binding protein (GAB) gene family. These proteins contain pleckstrin homology (PH) domain, and bind SHP2 tyrosine phosphatase and GRB2 adapter protein. They act as adapters for transmitting various signals in response to stimuli through cytokine and growth factor receptors, and T- and B-cell antigen receptors. The protein encoded by this gene is the principal activator of phosphatidylinositol-3 kinase in response to activation of the high affinity IgE receptor. Two alternatively spliced transcripts encoding different isoforms have been described for this gene. [provided by RefSeq, Nov 2009]

Uniprot Description

Adapter protein which acts downstream of several membrane receptors including cytokine, antigen, hormone, cell matrix and growth factor receptors to regulate multiple signaling pathways. Regulates osteoclast differentiation mediating the TNFRSF11A/RANK signaling. In allergic response, it plays a role in mast cells activation and degranulation through PI-3-kinase regulation. Also involved in the regulation of cell proliferation and hematopoiesis.