Western Blot (WB)
(WB Suggested Anti-FYB AntibodyTitration: 1.0 ug/mlPositive Control: A549 Whole Cell)
Rabbit FYB1 Polyclonal Antibody | anti-FYB1 antibody
FYB1 Antibody - C-terminal region
Gene Names
FYB1; FYB; ADAP; THC3; PRO0823; SLAP130; SLAP-130
Reactivity
Dog, Horse, Human, Mouse
Applications
Western Blot
Purity
Affinity Purified
Synonyms
FYB1; Polyclonal Antibody; FYB1 Antibody - C-terminal region; anti-FYB1 antibody
Host
Rabbit
Reactivity
Dog, Horse, Human, Mouse
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MGDEVYDDVDTSDFPVSSAEMSQGTNVGKAKTEEKDLKKLKKQEKEEKDF
Sequence Length
829
Applicable Applications for anti-FYB1 antibody
Western Blot (WB)
Homology
Dog: 100%; Horse: 79%; Human: 100%; Mouse: 75%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-FYB AntibodyTitration: 1.0 ug/mlPositive Control: A549 Whole Cell)
Western Blot (WB)
(WB Suggested Anti-FYB AntibodyTitration: 1.0 ug/mlPositive Control: A549 Whole Cell)
Related Product Information for anti-FYB1 antibody
This is a rabbit polyclonal antibody against FYB. It was validated on Western Blot
Target Description: The protein encoded by this gene is an adapter for the FYN protein and LCP2 signaling cascades in T-cells. The encoded protein is involved in platelet activation and controls the expression of interleukin-2. Three transcript variants encoding different isoforms have been found for this gene.
Target Description: The protein encoded by this gene is an adapter for the FYN protein and LCP2 signaling cascades in T-cells. The encoded protein is involved in platelet activation and controls the expression of interleukin-2. Three transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-FYB1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
96kDa
NCBI Official Full Name
FYN-binding protein 1 isoform 2
NCBI Official Synonym Full Names
FYN binding protein 1
NCBI Official Symbol
FYB1
NCBI Official Synonym Symbols
FYB; ADAP; THC3; PRO0823; SLAP130; SLAP-130
NCBI Protein Information
FYN-binding protein 1
NCBI Description
The protein encoded by this gene is an adapter for the FYN protein and LCP2 signaling cascades in T-cells. The encoded protein is involved in platelet activation and controls the expression of interleukin-2. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2011]
Research Articles on FYB1
Similar Products
Product Notes
The FYB1 (Catalog #AAA3216040) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FYB1 Antibody - C-terminal region reacts with Dog, Horse, Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's FYB1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the FYB1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MGDEVYDDVD TSDFPVSSAE MSQGTNVGKA KTEEKDLKKL KKQEKEEKDF. It is sometimes possible for the material contained within the vial of "FYB1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
