Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: FUT8Sample Type: Lymph Node TumorAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human FUT8 Polyclonal Antibody | anti-FUT8 antibody

FUT8 Antibody - Middle region

Gene Names
FUT8; CDGF; CDGF1
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
FUT8; Polyclonal Antibody; FUT8 Antibody - Middle region; anti-FUT8 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EGPIDQGPAIGRVRVLEEQLVKAKEQIENYKKQTRNGLGKDHEILRRRIE
Sequence Length
308
Applicable Applications for anti-FUT8 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the Middle region of Human FUT8
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: FUT8Sample Type: Lymph Node TumorAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: FUT8Sample Type: Lymph Node TumorAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-FUT8 antibody
This is a rabbit polyclonal antibody against FUT8. It was validated on Western Blot

Target Description: This gene encodes an enzyme belonging to the family of fucosyltransferases. The product of this gene catalyzes the transfer of fucose from GDP-fucose to N-linked type complex glycopeptides. This enzyme is distinct from other fucosyltransferases which catalyze alpha1-2, alpha1-3, and alpha1-4 fucose addition. The expression of this gene may contribute to the malignancy of cancer cells and to their invasive and metastatic capabilities. Alternative splicing results in multiple transcript variants.
Product Categories/Family for anti-FUT8 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
33 kDa
NCBI Official Full Name
Alpha-(1,6)-fucosyltransferase
NCBI Official Synonym Full Names
fucosyltransferase 8
NCBI Official Symbol
FUT8
NCBI Official Synonym Symbols
CDGF; CDGF1
NCBI Protein Information
alpha-(1,6)-fucosyltransferase
UniProt Protein Name
Alpha-(1,6)-fucosyltransferase
UniProt Gene Name
FUT8
UniProt Synonym Gene Names
Alpha1-6FucT
UniProt Entry Name
FUT8_HUMAN

NCBI Description

This gene encodes an enzyme belonging to the family of fucosyltransferases. The product of this gene catalyzes the transfer of fucose from GDP-fucose to N-linked type complex glycopeptides. This enzyme is distinct from other fucosyltransferases which catalyze alpha1-2, alpha1-3, and alpha1-4 fucose addition. The expression of this gene may contribute to the malignancy of cancer cells and to their invasive and metastatic capabilities. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2011]

Uniprot Description

FUT8: Catalyzes the addition of fucose in alpha 1-6 linkage to the first GlcNAc residue, next to the peptide chains in N-glycans. Belongs to the glycosyltransferase 23 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Motility/polarity/chemotaxis; Glycan Metabolism - N-glycan biosynthesis; Glycan Metabolism - keratan sulfate biosynthesis; Transferase; Membrane protein, integral; EC 2.4.1.68

Chromosomal Location of Human Ortholog: 14q24.3

Cellular Component: Golgi membrane; Golgi apparatus; membrane; cytoplasm; integral to membrane

Molecular Function: glycoprotein 6-alpha-L-fucosyltransferase activity; SH3 domain binding

Biological Process: integrin-mediated signaling pathway; cell migration; receptor metabolic process; in utero embryonic development; oligosaccharide biosynthetic process; protein amino acid N-linked glycosylation; respiratory gaseous exchange; post-translational protein modification; GDP-L-fucose metabolic process; cellular protein metabolic process; transforming growth factor beta receptor signaling pathway; protein amino acid glycosylation in Golgi; protein amino acid N-linked glycosylation via asparagine; L-fucose catabolic process; N-glycan processing

Research Articles on FUT8

Similar Products

Product Notes

The FUT8 fut8 (Catalog #AAA3214953) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FUT8 Antibody - Middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FUT8 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the FUT8 fut8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EGPIDQGPAI GRVRVLEEQL VKAKEQIENY KKQTRNGLGK DHEILRRRIE. It is sometimes possible for the material contained within the vial of "FUT8, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.