Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-FUT3 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Kidney)

Rabbit anti-Human, Pig FUT3 Polyclonal Antibody | anti-FUT3 antibody

FUT3 antibody - C-terminal region

Gene Names
FUT3; LE; Les; FT3B; CD174; FucT-III
Reactivity
Human, Pig
Applications
Western Blot
Purity
Affinity Purified
Synonyms
FUT3; Polyclonal Antibody; FUT3 antibody - C-terminal region; anti-FUT3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Pig
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RSNYERFLPPDAFIHVDDFQSPKDLARYLQELDKDHARYLSYFRWRETLR
Sequence Length
361
Applicable Applications for anti-FUT3 antibody
Western Blot (WB)
Homology
Human: 100%; Pig: 77%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-FUT3 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Kidney)

Western Blot (WB) (WB Suggested Anti-FUT3 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Kidney)
Related Product Information for anti-FUT3 antibody
This is a rabbit polyclonal antibody against FUT3. It was validated on Western Blot

Target Description: The Lewis histo-blood group system comprises a set of fucosylated glycosphingolipids that are synthesized by exocrine epithelial cells and circulate in body fluids. The glycosphingolipids function in embryogenesis, tissue differentiation, tumor metastasis, inflammation, and bacterial adhesion. They are secondarily absorbed to red blood cells giving rise to their Lewis phenotype. This gene is a member of the fucosyltransferase family, which catalyzes the addition of fucose to precursor polysaccharides in the last step of Lewis antigen biosynthesis. It encodes an enzyme with alpha(1,3)-fucosyltransferase and alpha(1,4)-fucosyltransferase activities. Mutations in this gene are responsible for the majority of Lewis antigen-negative phenotypes. Multiple alternatively spliced variants, encoding the same protein, have been found for this gene.
Product Categories/Family for anti-FUT3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42kDa
NCBI Official Full Name
galactoside 3(4)-L-fucosyltransferase
NCBI Official Synonym Full Names
fucosyltransferase 3 (Lewis blood group)
NCBI Official Symbol
FUT3
NCBI Official Synonym Symbols
LE; Les; FT3B; CD174; FucT-III
NCBI Protein Information
galactoside 3(4)-L-fucosyltransferase
UniProt Protein Name
Galactoside 3(4)-L-fucosyltransferase
Protein Family
UniProt Gene Name
FUT3
UniProt Synonym Gene Names
FT3B; LE; Lewis FT; FucT-III
UniProt Entry Name
FUT3_HUMAN

NCBI Description

The Lewis histo-blood group system comprises a set of fucosylated glycosphingolipids that are synthesized by exocrine epithelial cells and circulate in body fluids. The glycosphingolipids function in embryogenesis, tissue differentiation, tumor metastasis, inflammation, and bacterial adhesion. They are secondarily absorbed to red blood cells giving rise to their Lewis phenotype. This gene is a member of the fucosyltransferase family, which catalyzes the addition of fucose to precursor polysaccharides in the last step of Lewis antigen biosynthesis. It encodes an enzyme with alpha(1,3)-fucosyltransferase and alpha(1,4)-fucosyltransferase activities. Mutations in this gene are responsible for the majority of Lewis antigen-negative phenotypes. Multiple alternatively spliced variants, encoding the same protein, have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

FUT3: May catalyze alpha-1,3 and alpha-1,4 glycosidic linkages involved in the expression of Vim-2, Lewis A, Lewis B, sialyl Lewis X and Lewis X/SSEA-1 antigens. May be involved in blood group Lewis determination; Lewis-positive (Le(+)) individuals have an active enzyme while Lewis-negative (Le(-)) individuals have an inactive enzyme. Also acts on the corresponding 1,4-galactosyl derivative, forming 1,3-L-fucosyl links. Belongs to the glycosyltransferase 10 family.

Protein type: Glycan Metabolism - glycosphingolipid biosynthesis - lacto and neolacto series; Transferase; Membrane protein, integral; EC 2.4.1.65

Chromosomal Location of Human Ortholog: 19p13.3

Cellular Component: membrane; integral to membrane

Molecular Function: 3-galactosyl-N-acetylglucosaminide 4-alpha-L-fucosyltransferase activity; alpha(1,3)-fucosyltransferase activity; fucosyltransferase activity

Biological Process: cell-cell recognition; biopolymer glycosylation; oligosaccharide biosynthetic process; protein amino acid glycosylation

Research Articles on FUT3

Similar Products

Product Notes

The FUT3 fut3 (Catalog #AAA3216231) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FUT3 antibody - C-terminal region reacts with Human, Pig and may cross-react with other species as described in the data sheet. AAA Biotech's FUT3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the FUT3 fut3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RSNYERFLPP DAFIHVDDFQ SPKDLARYLQ ELDKDHARYL SYFRWRETLR. It is sometimes possible for the material contained within the vial of "FUT3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.