Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of FRMD8 expression in Raw 264.7 cells using antibody MBS6000354.)

Mouse anti-Human, Mouse FRMD8 Polyclonal Antibody | anti-FRMD8 antibody

FRMD8 (FERM Domain-containing Protein 8, FKSG44, FLJ32216, FLJ90369, MGC31785)

Gene Names
FRMD8; FKSG44
Reactivity
Human, Mouse
Applications
Western Blot, Immunofluorescence
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
FRMD8; Polyclonal Antibody; FRMD8 (FERM Domain-containing Protein 8; FKSG44; FLJ32216; FLJ90369; MGC31785); Anti -FRMD8 (FERM Domain-containing Protein 8; anti-FRMD8 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human FRMD8. Species Crossreactivity: mouse.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MDGTEGSAGQPGPAERSHRSSVSSVGARAADVLVYLADDTVVPLAVENLPSLSAHELHRAVREVLQLPDIALDVFALWLVSPLLEVQLKPKHQPYKLGRQWPELLLRFTSAPDDDVAMDEPFLQFRRNVFFPKRRELQIHDEEVLRLLYEEAKGNVLAARYPCDVEDCEALGALVCRVQLGPYQPGRPAACDLREKLDSFLPAHLCKRGQSLFAALRGRGARAGPGEQGLLNAYRQVQEVSSDGGCEAALGTHYRAYLLKCHELPFYGCAFFHGEVDKPAQGFLHRGGRKPVSVAISLEGVHVIDSREKHVLLGLRFQELSWDHTSPEEEEPILWLEFDGDSEGTPVNKLLKIYSKQAELMSSLIEYCIELSQAAEPAGPQDSATGSPSDPSSSLAPVQRPKLRRQGSVVSSRIQHLSTIDYVEDGKGIRRVKPKRTTSFFSRQLSLGQGSYTVVQPGDSLEQG
Applicable Applications for anti-FRMD8 antibody
Western Blot (WB), Immunofluorescence (IF)
Application Notes
Suitable for use in Immunofluorescence and Western Blot.
Dilution: Immunofluorescence: 20ug/ml
Immunogen
Full length human FRMD8, aa1-464 (NP_114110.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of FRMD8 expression in Raw 264.7 cells using antibody MBS6000354.)

Western Blot (WB) (Western Blot analysis of FRMD8 expression in Raw 264.7 cells using antibody MBS6000354.)

Western Blot (WB)

(Western Blot analysis of FKSG44 expression in NIH/3T3 cells using antibody MBS6000354.)

Western Blot (WB) (Western Blot analysis of FKSG44 expression in NIH/3T3 cells using antibody MBS6000354.)

Western Blot (WB)

(Western Blot analysis of FRMD8 expression in transfected 293T cells using antibody MBS6000354. Lane 1: FKSG44 transfected lysate (51.04kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of FRMD8 expression in transfected 293T cells using antibody MBS6000354. Lane 1: FKSG44 transfected lysate (51.04kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence staining of FRMD8 in HeLa cells using antibody MBS6000354.)

Immunofluorescence (IF) (Immunofluorescence staining of FRMD8 in HeLa cells using antibody MBS6000354.)
Related Product Information for anti-FRMD8 antibody
The function of this protein remains unknown.
Product Categories/Family for anti-FRMD8 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
51,218 Da
NCBI Official Full Name
FRMD8 protein
NCBI Official Synonym Full Names
FERM domain containing 8
NCBI Official Symbol
FRMD8
NCBI Official Synonym Symbols
FKSG44
NCBI Protein Information
FERM domain-containing protein 8; FKSG44
UniProt Protein Name
FERM domain-containing protein 8
UniProt Gene Name
FRMD8
UniProt Entry Name
FRMD8_HUMAN

Uniprot Description

FRMD8: 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cytoskeletal

Chromosomal Location of Human Ortholog: 11q13

Cellular Component: cytoskeleton

Similar Products

Product Notes

The FRMD8 frmd8 (Catalog #AAA6000354) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The FRMD8 (FERM Domain-containing Protein 8, FKSG44, FLJ32216, FLJ90369, MGC31785) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's FRMD8 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunofluorescence (IF). Suitable for use in Immunofluorescence and Western Blot. Dilution: Immunofluorescence: 20ug/ml. Researchers should empirically determine the suitability of the FRMD8 frmd8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MDGTEGSAGQ PGPAERSHRS SVSSVGARAA DVLVYLADDT VVPLAVENLP SLSAHELHRA VREVLQLPDI ALDVFALWLV SPLLEVQLKP KHQPYKLGRQ WPELLLRFTS APDDDVAMDE PFLQFRRNVF FPKRRELQIH DEEVLRLLYE EAKGNVLAAR YPCDVEDCEA LGALVCRVQL GPYQPGRPAA CDLREKLDSF LPAHLCKRGQ SLFAALRGRG ARAGPGEQGL LNAYRQVQEV SSDGGCEAAL GTHYRAYLLK CHELPFYGCA FFHGEVDKPA QGFLHRGGRK PVSVAISLEG VHVIDSREKH VLLGLRFQEL SWDHTSPEEE EPILWLEFDG DSEGTPVNKL LKIYSKQAEL MSSLIEYCIE LSQAAEPAGP QDSATGSPSD PSSSLAPVQR PKLRRQGSVV SSRIQHLSTI DYVEDGKGIR RVKPKRTTSF FSRQLSLGQG SYTVVQPGDS LEQG. It is sometimes possible for the material contained within the vial of "FRMD8, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.