Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-FPR1 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Heart)

Rabbit FPR1 Polyclonal Antibody | anti-FPR1 antibody

FPR1 antibody - middle region

Gene Names
FPR1; FPR; FMLP
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
FPR1; Polyclonal Antibody; FPR1 antibody - middle region; anti-FPR1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VACTFNFSPWTNDPKERINVAVAMLTVRGIIRFIIGFSAPMSIVAVSYGL
Sequence Length
350
Applicable Applications for anti-FPR1 antibody
Western Blot (WB)
Homology
Human: 100%; Mouse: 82%; Rat: 82%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-FPR1 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Heart)

Western Blot (WB) (WB Suggested Anti-FPR1 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Heart)
Related Product Information for anti-FPR1 antibody
This is a rabbit polyclonal antibody against FPR1. It was validated on Western Blot

Target Description: This gene encodes a G protein-coupled receptor of mammalian phagocytic cells that is a member of the G-protein coupled receptor 1 family. The protein mediates the response of phagocytic cells to invasion of the host by microorganisms and is important in host defense and inflammation.
Product Categories/Family for anti-FPR1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38kDa
NCBI Official Full Name
fMet-Leu-Phe receptor
NCBI Official Synonym Full Names
formyl peptide receptor 1
NCBI Official Symbol
FPR1
NCBI Official Synonym Symbols
FPR; FMLP
NCBI Protein Information
fMet-Leu-Phe receptor
UniProt Protein Name
fMet-Leu-Phe receptor
Protein Family
UniProt Gene Name
FPR1
UniProt Synonym Gene Names
fMLP receptor; FPR
UniProt Entry Name
FPR1_HUMAN

NCBI Description

This gene encodes a G protein-coupled receptor of mammalian phagocytic cells that is a member of the G-protein coupled receptor 1 family. The protein mediates the response of phagocytic cells to invasion of the host by microorganisms and is important in host defense and inflammation.[provided by RefSeq, Jul 2010]

Uniprot Description

FPR1: High affinity receptor for N-formyl-methionyl peptides, which are powerful neutrophils chemotactic factors. Binding of FMLP to the receptor causes activation of neutrophils. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system. Belongs to the G-protein coupled receptor 1 family.

Protein type: Receptor, GPCR; Membrane protein, integral; Membrane protein, multi-pass; Motility/polarity/chemotaxis; GPCR, family 1

Chromosomal Location of Human Ortholog: 19q13.4

Cellular Component: integral to membrane; plasma membrane; endosome

Molecular Function: protein binding; RAGE receptor binding; N-formyl peptide receptor activity; receptor activity

Biological Process: G-protein signaling, coupled to cAMP nucleotide second messenger; G-protein coupled receptor protein signaling pathway; activation of MAPK activity; G-protein signaling, coupled to IP3 second messenger (phospholipase C activating); signal transduction; cell motility; chemotaxis; nitric oxide mediated signal transduction

Research Articles on FPR1

Similar Products

Product Notes

The FPR1 fpr1 (Catalog #AAA3216182) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FPR1 antibody - middle region reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's FPR1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the FPR1 fpr1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VACTFNFSPW TNDPKERINV AVAMLTVRGI IRFIIGFSAP MSIVAVSYGL. It is sometimes possible for the material contained within the vial of "FPR1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.