Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Rabbit FOXK1 Polyclonal Antibody | anti-FOXK1 antibody

FOXK1 antibody - C-terminal region

Gene Names
Foxk1; Mnf; Gm10868; AI463295; A630048H08Rik
Reactivity
Guinea Pig, Mouse, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Protein A purified
Synonyms
FOXK1; Polyclonal Antibody; FOXK1 antibody - C-terminal region; anti-FOXK1 antibody
Ordering
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
For Research Use Only!
Host
Rabbit
Reactivity
Guinea Pig, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VVQQAPTVTMVRVVTTSANSANGYILASQGSTGTSHDTAGTAVLDLGNEA
Sequence Length
617
Applicable Applications for anti-FOXK1 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Guinea Pig: 86%; Mouse: 100%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of mouse FOXK1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Mouse Kidney )

Western Blot (WB)

(WB Suggested Anti-FOXK1 Antibody Titration: 2.5ug/mlPositive Control: NIH/3T3 cell lysate)

Related Product Information for anti-FOXK1 antibody
This is a rabbit polyclonal antibody against FOXK1. It was validated on Western Blot and immunohistochemistry

Target Description: Foxk1 is a transcriptional regulator that binds to the upstream enhancer region (CCAC box) of myoglobin gene. It has a role in myogenic differentiation and in remodeling processes of adult muscles that occur in response to physiological stimuli.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
68kDa
NCBI Official Full Name
forkhead box protein K1
NCBI Official Synonym Full Names
forkhead box K1
NCBI Official Symbol
Foxk1
NCBI Official Synonym Symbols
Mnf; Gm10868; AI463295; A630048H08Rik
NCBI Protein Information
forkhead box protein K1
UniProt Protein Name
Forkhead box protein K1
Protein Family
UniProt Gene Name
Foxk1
UniProt Synonym Gene Names
Mnf; MNF
UniProt Entry Name
FOXK1_MOUSE

Research Articles on FOXK1

Similar Products

Product Notes

The FOXK1 foxk1 (Catalog #AAA3203678) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FOXK1 antibody - C-terminal region reacts with Guinea Pig, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's FOXK1 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the FOXK1 foxk1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VVQQAPTVTM VRVVTTSANS ANGYILASQG STGTSHDTAG TAVLDLGNEA. It is sometimes possible for the material contained within the vial of "FOXK1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.
Looking for a specific manual?
Request a Manual