Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-FOXJ1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: MCF7 cell lysate)

Rabbit FOXJ1 Polyclonal Antibody | anti-FOXJ1 antibody

FOXJ1 antibody - middle region

Gene Names
FOXJ1; HFH4; HFH-4; FKHL13
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
FOXJ1; Polyclonal Antibody; FOXJ1 antibody - middle region; anti-FOXJ1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LGALEALELSPPLSPASHVDVDLTIHGRHIDCPATWGPSVEQAADSLDFD
Sequence Length
421
Applicable Applications for anti-FOXJ1 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 92%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 86%; Pig: 93%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human FOXJ1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-FOXJ1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: MCF7 cell lysate)

Western Blot (WB) (WB Suggested Anti-FOXJ1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: MCF7 cell lysate)
Related Product Information for anti-FOXJ1 antibody
This is a rabbit polyclonal antibody against FOXJ1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: FOXJ1 is a member of the forkhead family, which was originally identified in Drosophila. The forkhead family is composed of transcription factors with a conserved 100-amino acid DNA-binding motif.FOXJ1 is a member of the forkhead gene family, which was originally identified in Drosophila. The forkhead family is composed of transcription factors with a conserved 100-amino acid DNA-binding motif.[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-2401 BC046460.1 257-2657

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45kDa
NCBI Official Full Name
forkhead box protein J1
NCBI Official Synonym Full Names
forkhead box J1
NCBI Official Symbol
FOXJ1
NCBI Official Synonym Symbols
HFH4; HFH-4; FKHL13
NCBI Protein Information
forkhead box protein J1
UniProt Protein Name
Forkhead box protein J1
Protein Family
UniProt Gene Name
FOXJ1
UniProt Synonym Gene Names
FKHL13; HFH4; HFH-4
UniProt Entry Name
FOXJ1_HUMAN

NCBI Description

This gene encodes a member of the forkhead family of transcription factors. Similar genes in zebrafish and mouse have been shown to regulate the transcription of genes that control the production of motile cilia. The mouse ortholog also functions in the determination of left-right asymmetry. Polymorphisms in this gene are associated with systemic lupus erythematosus and allergic rhinitis.[provided by RefSeq, Sep 2009]

Uniprot Description

FOXJ1: May play an important role in cell fate determination during lung development and in spermatogenesis. Genetic variations in FOXJ1 may be associated with susceptibility to allergic rhinitis (ALRH). Allergic rhinitis is a common disease of complex inheritance and is characterized by mucosal inflammation caused by allergen exposure.

Protein type: DNA-binding; Transcription factor

Chromosomal Location of Human Ortholog: 17q25.1

Cellular Component: nucleus

Molecular Function: DNA binding; transcription factor activity

Biological Process: transcription from RNA polymerase II promoter; negative regulation of germinal center formation; positive regulation of central B cell tolerance induction; establishment of apical/basal cell polarity; negative regulation of B cell activation; negative regulation of interleukin-6 biosynthetic process; negative regulation of T cell differentiation in the thymus; negative regulation of transcription from RNA polymerase II promoter; pattern specification process; humoral immune response; negative regulation of humoral immune response mediated by circulating immunoglobulin; negative regulation of T cell proliferation; inhibition of NF-kappaB transcription factor; cilium biogenesis; positive regulation of transcription from RNA polymerase II promoter; spermatogenesis; brain development; actin cytoskeleton organization and biogenesis; leukocyte migration; central tolerance induction

Disease: Allergic Rhinitis

Research Articles on FOXJ1

Similar Products

Product Notes

The FOXJ1 foxj1 (Catalog #AAA3202675) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FOXJ1 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's FOXJ1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the FOXJ1 foxj1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LGALEALELS PPLSPASHVD VDLTIHGRHI DCPATWGPSV EQAADSLDFD. It is sometimes possible for the material contained within the vial of "FOXJ1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.