Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (34.65kD).)

Mouse anti-Human FOXJ1 Monoclonal Antibody | anti-FOXJ1 antibody

FOXJ1 (Forkhead Box Protein J1, Forkhead-related Protein FKHL13, Hepatocyte Nuclear Factor 3 Forkhead Homolog 4, HFH-4, FKHL13, HFH4) (MaxLight 550)

Gene Names
FOXJ1; HFH4; HFH-4; FKHL13
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
FOXJ1; Monoclonal Antibody; FOXJ1 (Forkhead Box Protein J1; Forkhead-related Protein FKHL13; Hepatocyte Nuclear Factor 3 Forkhead Homolog 4; HFH-4; FKHL13; HFH4) (MaxLight 550); anti-FOXJ1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
5B2
Specificity
Recognizes human FOXJ1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.
Applicable Applications for anti-FOXJ1 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa341-421 from human FOXJ1 with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
HVDVDLTIHGRHIDCPATWGPSVEQAADSLDFDETFLATSFLQHPWDESGSGCLPPEPLFEAGDATLASDLQDWASVGAFL
Conjugate
MaxLight550
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (34.65kD).)

Western Blot (WB) (Western Blot detection against Immunogen (34.65kD).)
Related Product Information for anti-FOXJ1 antibody
May play an important role in cell fate determination during lung development and in spermatogenesis.
Product Categories/Family for anti-FOXJ1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45kDa
NCBI Official Full Name
forkhead box protein J1
NCBI Official Synonym Full Names
forkhead box J1
NCBI Official Symbol
FOXJ1
NCBI Official Synonym Symbols
HFH4; HFH-4; FKHL13
NCBI Protein Information
forkhead box protein J1
UniProt Protein Name
Forkhead box protein J1
Protein Family
UniProt Gene Name
FOXJ1
UniProt Synonym Gene Names
FKHL13; HFH4; HFH-4
UniProt Entry Name
FOXJ1_HUMAN

NCBI Description

This gene encodes a member of the forkhead family of transcription factors. Similar genes in zebrafish and mouse have been shown to regulate the transcription of genes that control the production of motile cilia. The mouse ortholog also functions in the determination of left-right asymmetry. Polymorphisms in this gene are associated with systemic lupus erythematosus and allergic rhinitis.[provided by RefSeq, Sep 2009]

Uniprot Description

FOXJ1: May play an important role in cell fate determination during lung development and in spermatogenesis. Genetic variations in FOXJ1 may be associated with susceptibility to allergic rhinitis (ALRH). Allergic rhinitis is a common disease of complex inheritance and is characterized by mucosal inflammation caused by allergen exposure.

Protein type: DNA-binding; Transcription factor

Chromosomal Location of Human Ortholog: 17q25.1

Cellular Component: nucleus

Molecular Function: DNA binding; transcription factor activity

Biological Process: transcription from RNA polymerase II promoter; negative regulation of germinal center formation; positive regulation of central B cell tolerance induction; establishment of apical/basal cell polarity; negative regulation of B cell activation; negative regulation of interleukin-6 biosynthetic process; negative regulation of T cell differentiation in the thymus; negative regulation of transcription from RNA polymerase II promoter; pattern specification process; humoral immune response; negative regulation of humoral immune response mediated by circulating immunoglobulin; negative regulation of T cell proliferation; inhibition of NF-kappaB transcription factor; cilium biogenesis; positive regulation of transcription from RNA polymerase II promoter; spermatogenesis; brain development; actin cytoskeleton organization and biogenesis; leukocyte migration; central tolerance induction

Disease: Allergic Rhinitis

Research Articles on FOXJ1

Similar Products

Product Notes

The FOXJ1 foxj1 (Catalog #AAA6211563) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The FOXJ1 (Forkhead Box Protein J1, Forkhead-related Protein FKHL13, Hepatocyte Nuclear Factor 3 Forkhead Homolog 4, HFH-4, FKHL13, HFH4) (MaxLight 550) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FOXJ1 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the FOXJ1 foxj1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FOXJ1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.