Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-FOXF1 Antibody Titration: 1.25ug/mlELISA Titer: 1:1562500Positive Control: Jurkat cell lysate)

Rabbit FOXF1 Polyclonal Antibody | anti-FOXF1 antibody

FOXF1 antibody - N-terminal region

Gene Names
FOXF1; FKHL5; ACDMPV; FREAC1
Reactivity
Cow, Guinea Pig, Horse, Human, Rabbit
Applications
Western Blot
Purity
Protein A purified
Synonyms
FOXF1; Polyclonal Antibody; FOXF1 antibody - N-terminal region; anti-FOXF1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Guinea Pig, Horse, Human, Rabbit
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MDPASSGPSKAKKTNAGIRRPEKPPYSYIALIVMAIQSSPTKRLTLSEIY
Sequence Length
354
Applicable Applications for anti-FOXF1 antibody
Western Blot (WB)
Homology
Cow: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Rabbit: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human FOXF1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-FOXF1 Antibody Titration: 1.25ug/mlELISA Titer: 1:1562500Positive Control: Jurkat cell lysate)

Western Blot (WB) (WB Suggested Anti-FOXF1 Antibody Titration: 1.25ug/mlELISA Titer: 1:1562500Positive Control: Jurkat cell lysate)
Related Product Information for anti-FOXF1 antibody
This is a rabbit polyclonal antibody against FOXF1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: FOXF1 belongs to the forkhead family of transcription factors which is characterized by a distinct forkhead domain. The specific function of this gene has not yet been determined; however, it may play a role in the regulation of pulmonary genes as well as embryonic development.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38kDa
NCBI Official Full Name
forkhead box protein F1
NCBI Official Synonym Full Names
forkhead box F1
NCBI Official Symbol
FOXF1
NCBI Official Synonym Symbols
FKHL5; ACDMPV; FREAC1
NCBI Protein Information
forkhead box protein F1
UniProt Protein Name
Forkhead box protein F1
Protein Family
UniProt Gene Name
FOXF1
UniProt Synonym Gene Names
FKHL5; FREAC1; FREAC-1

NCBI Description

This gene belongs to the forkhead family of transcription factors which is characterized by a distinct forkhead domain. The specific function of this gene has not yet been determined; however, it may play a role in the regulation of pulmonary genes as well as embryonic development. [provided by RefSeq, Jul 2008]

Uniprot Description

FOXF1: Probable transcription activator for a number of lung- specific genes. Defects in FOXF1 are the cause of alveolar capillary dysplasia with misalignment of pulmonary veins (ACDMPV). ACDMPV is a rare malformation due to abnormal development of the capillary vascular system in the lungs. Histologically, it is characterized by failure of formation and ingrowth of alveolar capillaries, medial muscular thickening of small pulmonary arterioles with muscularization of the intraacinar arterioles, thickened alveolar walls, and anomalously situated pulmonary veins running alongside pulmonary arterioles and sharing the same adventitial sheath. Less common features include a reduced number of alveoli and a patchy distribution of the histopathologic changes. Affected infants present with respiratory distress and the disease is fatal within the newborn period. Additional features include multiple congenital anomalies affecting the cardiovascular, gastrointestinal, genitourinary, and musculoskeletal systems, as well as disruption of the normal right-left asymmetry of intrathoracic or intraabdominal organs. ACDMPV is a rare cause of persistent pulmonary hypertension of the newborn, an abnormal physiologic state caused by failure of transition of the pulmonary circulation from the high pulmonary vascular resistance of the fetus to the low pulmonary vascular resistance of the newborn.

Protein type: DNA-binding; Motility/polarity/chemotaxis; Transcription factor

Chromosomal Location of Human Ortholog: 16q24.1

Cellular Component: nucleus; transcription factor complex

Molecular Function: DNA binding; RNA polymerase II transcription factor activity, enhancer binding; sequence-specific DNA binding

Biological Process: blood vessel development; embryonic digestive tract morphogenesis; embryonic ectodermal gut morphogenesis; gut development; heart development; in utero embryonic development; lung development; midgut development; morphogenesis of a branching structure; pancreas development; positive regulation of transcription from RNA polymerase II promoter; positive regulation of transcription, DNA-dependent; respiratory tube development

Disease: Alveolar Capillary Dysplasia With Misalignment Of Pulmonary Veins

Research Articles on FOXF1

Similar Products

Product Notes

The FOXF1 foxf1 (Catalog #AAA3200556) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FOXF1 antibody - N-terminal region reacts with Cow, Guinea Pig, Horse, Human, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's FOXF1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the FOXF1 foxf1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MDPASSGPSK AKKTNAGIRR PEKPPYSYIA LIVMAIQSSP TKRLTLSEIY. It is sometimes possible for the material contained within the vial of "FOXF1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.