Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (FOSL1 rabbit polyclonal antibody. Western Blot analysis of FOSL1 expression in A-431.)

Rabbit anti-Human FOSL1 Polyclonal Antibody | anti-FOSL1 antibody

FOSL1 (Fos-related Antigen 1, FRA-1, FRA1) (Biotin)

Gene Names
FOSL1; FRA; FRA1; fra-1
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
FOSL1; Polyclonal Antibody; FOSL1 (Fos-related Antigen 1; FRA-1; FRA1) (Biotin); anti-FOSL1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human FOSL1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-FOSL1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human FOSL1, aa1-271 (NP_005429.1).
Immunogen Sequence
MFRDFGEPGPSSGNGGGYGGPAQPPAAAQAAQQKFHLVPSINTMSGSQELQWMVQPHFLGPSSYPRPLTYPQYSPPQPRPGVIRALGPPPGVRRRPCEQISPEEEERRRVRRERNKLAAAKCRNRRKELTDFLQAETDKLEDEKSGLQREIEELQKQKERLELVLEAHRPICKIPEGAKEGDTGSTSGTSSPPAPCRPVPCISLSPGPVLEPEALHTPTLMTTPSLTPFTPSLVFTYPSTPEPCASAHRKSSSSSGDPSSDPLGSPTLLAL
Conjugate
Biotin
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(FOSL1 rabbit polyclonal antibody. Western Blot analysis of FOSL1 expression in A-431.)

Western Blot (WB) (FOSL1 rabbit polyclonal antibody. Western Blot analysis of FOSL1 expression in A-431.)

Western Blot (WB)

(Western Blot analysis of FOSL1 expression in transfected 293T cell line by FOSL1 polyclonal antibody. Lane 1: FOSL1 transfected lysate (29.4kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of FOSL1 expression in transfected 293T cell line by FOSL1 polyclonal antibody. Lane 1: FOSL1 transfected lysate (29.4kD). Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-FOSL1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29,413 Da
NCBI Official Full Name
fos-related antigen 1
NCBI Official Synonym Full Names
FOS-like antigen 1
NCBI Official Symbol
FOSL1
NCBI Official Synonym Symbols
FRA; FRA1; fra-1
NCBI Protein Information
fos-related antigen 1; FOS-like antigen-1
UniProt Protein Name
Fos-related antigen 1
Protein Family
UniProt Gene Name
FOSL1
UniProt Synonym Gene Names
FRA1; FRA-1
UniProt Entry Name
FOSL1_HUMAN

NCBI Description

The Fos gene family consists of 4 members: FOS, FOSB, FOSL1, and FOSL2. These genes encode leucine zipper proteins that can dimerize with proteins of the JUN family, thereby forming the transcription factor complex AP-1. As such, the FOS proteins have been implicated as regulators of cell proliferation, differentiation, and transformation. [provided by RefSeq, Jul 2008]

Uniprot Description

FRA1: an oncogenic transcription factor of the bZIP family, Fos subfamily. The expression of Fos proteins is rapidly and transiently induced by a variety of extracellular stimuli including growth factors, cytokines, neurotransmitters, polypeptide hormones, and stress. Fos proteins dimerize with Jun proteins (c-Jun, JunB, and JunD) to form Activator Protein-1 (AP-1), a transcription factor that binds to TRE/AP-1 elements and activates transcription. Fos and Jun proteins contain the leucine-zipper motif that mediates dimerization and an adjacent basic domain that binds to DNA. The various Fos/Jun heterodimers differ in their ability to transactivate AP-1 dependent genes. In addition to increased expression, phosphorylation of Fos proteins by Erk kinases in response to extracellular stimuli may further increase transcriptional activity. Following growth factor stimulation, expression of FosB and c-Fos in quiescent fibroblasts is immediate but short-lived, while FRA1 and FRA2 expression persists longer. FRA1 is involved in cell motility, invasiveness, and inhibits apoptosis. Elevated in many cancers and associated with tumorigenesis and cancer progression. Involved in Erk2-mediated Epithelial-to-Mesenchymal Transition (EMT) pathway. ERK2/FRA2 regulate ZEB1/2 expression, known to be associated with the EMT. Smad2/3-Fra1 complexes may reflect activation of the Smad/AP-1-dependent TGF¿-induced breast cancer invasion program. Activation of FRA1/C-JUN by ERK/AKT pathways can induce EZH2 overexpression, silencing integrin alpha-2 expression, and increasing the metastatic potential of colorectal cancer. Belongs to the bZIP family. Fos subfamily.

Protein type: DNA-binding; Transcription factor

Chromosomal Location of Human Ortholog: 11q13

Cellular Component: nucleoplasm; presynaptic membrane; neuron projection; nucleus; cytosol

Molecular Function: protein binding; transcription factor activity

Biological Process: response to drug; transcription from RNA polymerase II promoter; response to gravity; response to cAMP; in utero embryonic development; positive regulation of apoptosis; response to virus; vitellogenesis; positive regulation of cell cycle; female pregnancy; learning; chemotaxis; regulation of transcription from RNA polymerase II promoter; negative regulation of cell proliferation; response to hydrogen peroxide; response to mechanical stimulus; response to cytokine stimulus; positive regulation of cell proliferation; cellular response to extracellular stimulus; cellular defense response; positive regulation of transcription factor activity; response to progesterone stimulus; response to corticosterone stimulus

Research Articles on FOSL1

Similar Products

Product Notes

The FOSL1 fosl1 (Catalog #AAA6378825) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FOSL1 (Fos-related Antigen 1, FRA-1, FRA1) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FOSL1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the FOSL1 fosl1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FOSL1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.