Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: FOSSample Tissue: Human HepG2 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human FOS Polyclonal Antibody | anti-FOS antibody

FOS Antibody - middle region

Gene Names
FOS; p55; AP-1; C-FOS
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
FOS; Polyclonal Antibody; FOS Antibody - middle region; anti-FOS antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DFLFPASSRPSGSETARSVPDMDLSGSFYAADWEPLHSGSLGMGPMATEL
Sequence Length
344
Applicable Applications for anti-FOS antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human FOS
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: FOSSample Tissue: Human HepG2 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: FOSSample Tissue: Human HepG2 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-FOS antibody
The Fos gene family consists of 4 members: FOS, FOSB, FOSL1, and FOSL2. These genes encode leucine zipper proteins that can dimerize with proteins of the JUN family, thereby forming the transcription factor complex AP-1. As such, the FOS proteins have been implicated as regulators of cell proliferation, differentiation, and transformation. In some cases, expression of the FOS gene has also been associated with apoptotic cell death.
Product Categories/Family for anti-FOS antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37 kDa
NCBI Official Full Name
proto-oncogene c-Fos
NCBI Official Synonym Full Names
Fos proto-oncogene, AP-1 transcription factor subunit
NCBI Official Symbol
FOS
NCBI Official Synonym Symbols
p55; AP-1; C-FOS
NCBI Protein Information
proto-oncogene c-Fos
UniProt Protein Name
Proto-oncogene c-Fos
Protein Family
UniProt Gene Name
FOS
UniProt Synonym Gene Names
G0S7
UniProt Entry Name
FOS_HUMAN

NCBI Description

The Fos gene family consists of 4 members: FOS, FOSB, FOSL1, and FOSL2. These genes encode leucine zipper proteins that can dimerize with proteins of the JUN family, thereby forming the transcription factor complex AP-1. As such, the FOS proteins have been implicated as regulators of cell proliferation, differentiation, and transformation. In some cases, expression of the FOS gene has also been associated with apoptotic cell death. [provided by RefSeq, Jul 2008]

Uniprot Description

Fos: a proto-oncogenic transcription factor of the bZIP family. Dimerizes with proteins of the JUN family, thereby forming the transcription factor complex AP-1. FOS proteins function as regulators of cell proliferation, differentiation, and transformation. In some cases, expression of FOS has also been associated with apoptotic cell death. Expression increases upon a variety of stimuli, including growth factors, cytokines, neurotransmitters, polypeptide hormones, stress and cell injury.

Protein type: Motility/polarity/chemotaxis; DNA-binding; Transcription factor; Oncoprotein

Chromosomal Location of Human Ortholog: 14q24.3

Cellular Component: nucleoplasm; transcription factor complex; neuron projection; membrane; endoplasmic reticulum; nucleus; cytosol

Molecular Function: protein binding; double-stranded DNA binding; transcription factor activity; transcription factor binding

Biological Process: transcription from RNA polymerase II promoter; response to gravity; response to cAMP; positive regulation of osteoclast differentiation; response to toxin; positive regulation of transcription, DNA-dependent; stress-activated MAPK cascade; response to lipopolysaccharide; toll-like receptor 3 signaling pathway; female pregnancy; toll-like receptor 10 signaling pathway; toll-like receptor 5 signaling pathway; regulation of transcription factor activity; transforming growth factor beta receptor signaling pathway; conditioned taste aversion; DNA methylation; inflammatory response; toll-like receptor 4 signaling pathway; aging; response to corticosterone stimulus; response to drug; response to light stimulus; nervous system development; MyD88-independent toll-like receptor signaling pathway; sleep; cellular response to hormone stimulus; toll-like receptor 2 signaling pathway; regulation of transcription from RNA polymerase II promoter; MyD88-dependent toll-like receptor signaling pathway; response to mechanical stimulus; response to cytokine stimulus; cellular response to extracellular stimulus; toll-like receptor signaling pathway; innate immune response; positive regulation of transcription from RNA polymerase II promoter; toll-like receptor 9 signaling pathway; response to cold; response to progesterone stimulus

Research Articles on FOS

Similar Products

Product Notes

The FOS fos (Catalog #AAA3224202) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FOS Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FOS can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the FOS fos for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DFLFPASSRP SGSETARSVP DMDLSGSFYA ADWEPLHSGS LGMGPMATEL. It is sometimes possible for the material contained within the vial of "FOS, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.