Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of FOLR3 expression in transfected 293T cell line by FOLR3 polyclonal antibody. Lane 1: FOLR3 transfected lysate (26.95kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human FOLR3 Polyclonal Antibody | anti-FOLR3 antibody

FOLR3 (Folate Receptor gamma, FR-gamma, Folate Receptor 3) (PE)

Gene Names
FOLR3; FR-G; FRgamma; FR-gamma; gamma-hFR
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
FOLR3; Polyclonal Antibody; FOLR3 (Folate Receptor gamma; FR-gamma; Folate Receptor 3) (PE); anti-FOLR3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human FOLR3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Sequence Length
799
Applicable Applications for anti-FOLR3 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human FOLR3, aa1-245 (AAI48786.1).
Immunogen Sequence
MDMAWQMMQLLLLALVTAAGSAQPRSARARTDLLNVCMNAKHHKTQPSPEDELYGQCSPWKKNACCTASTSQELHKDTSRLYNFNWDHCGKMEPTCKRHFIQDSCLYECSPNLGPWIRQVNQSWRKERILNVPLCKEDCERWWEDCRTSYTCKSNWHKGWNWTSGINECPAGALCSTFESYFPTPAALCEGLWSHSFKVSNYSRGSGRCIQMWFDSAQGNPNEEVAKFYAAAMNAGAPSRGIIDS
Conjugate
PE
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of FOLR3 expression in transfected 293T cell line by FOLR3 polyclonal antibody. Lane 1: FOLR3 transfected lysate (26.95kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of FOLR3 expression in transfected 293T cell line by FOLR3 polyclonal antibody. Lane 1: FOLR3 transfected lysate (26.95kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-FOLR3 antibody
Binds to folate and reduced folic acid derivatives and mediates delivery of 5-methyltetrahydrofolate to the interior of cells. Isoform Short does not bind folate.
Product Categories/Family for anti-FOLR3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
Synthetic construct Homo sapiens clone IMAGE:100015838, MGC:183190 folate receptor 3 (gamma) (FOLR3) mRNA, encodes complete protein
NCBI Official Synonym Full Names
folate receptor gamma
NCBI Official Symbol
FOLR3
NCBI Official Synonym Symbols
FR-G; FRgamma; FR-gamma; gamma-hFR
NCBI Protein Information
folate receptor gamma
Protein Family

NCBI Description

This gene encodes a member of the folate receptor (FOLR) family of proteins, which have a high affinity for folic acid and for several reduced folic acid derivatives, and mediate delivery of 5-methyltetrahydrofolate to the interior of cells. Expression of this gene may be elevated in ovarian and primary peritoneal carcinoma. This gene is present in a gene cluster on chromosome 11. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2015]

Research Articles on FOLR3

Similar Products

Product Notes

The FOLR3 (Catalog #AAA6378811) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FOLR3 (Folate Receptor gamma, FR-gamma, Folate Receptor 3) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FOLR3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the FOLR3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FOLR3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.