Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of FOLR3 expression in transfected 293T cell line by FOLR3 polyclonal antibody. Lane 1: FOLR3 transfected lysate (26.95kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human FOLR3 Polyclonal Antibody | anti-FOLR3 antibody

FOLR3 (Folate Receptor gamma, FR-gamma, Folate Receptor 3)

Gene Names
FOLR3; FR-G; FR-gamma; gamma-hFR
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
FOLR3; Polyclonal Antibody; FOLR3 (Folate Receptor gamma; FR-gamma; Folate Receptor 3); Anti -FOLR3 (Folate Receptor gamma; anti-FOLR3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human FOLR3.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MDMAWQMMQLLLLALVTAAGSAQPRSARARTDLLNVCMNAKHHKTQPSPEDELYGQCSPWKKNACCTASTSQELHKDTSRLYNFNWDHCGKMEPTCKRHFIQDSCLYECSPNLGPWIRQVNQSWRKERILNVPLCKEDCERWWEDCRTSYTCKSNWHKGWNWTSGINECPAGALCSTFESYFPTPAALCEGLWSHSFKVSNYSRGSGRCIQMWFDSAQGNPNEEVAKFYAAAMNAGAPSRGIIDS
Applicable Applications for anti-FOLR3 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human FOLR3, aa1-245 (AAI48786.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of FOLR3 expression in transfected 293T cell line by FOLR3 polyclonal antibody. Lane 1: FOLR3 transfected lysate (26.95kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of FOLR3 expression in transfected 293T cell line by FOLR3 polyclonal antibody. Lane 1: FOLR3 transfected lysate (26.95kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-FOLR3 antibody
Binds to folate and reduced folic acid derivatives and mediates delivery of 5-methyltetrahydrofolate to the interior of cells. Isoform Short does not bind folate.
Product Categories/Family for anti-FOLR3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27,638 Da
NCBI Official Full Name
folate receptor gamma
NCBI Official Synonym Full Names
folate receptor 3 (gamma)
NCBI Official Symbol
FOLR3
NCBI Official Synonym Symbols
FR-G; FR-gamma; gamma-hFR
NCBI Protein Information
folate receptor gamma
UniProt Protein Name
Folate receptor gamma
Protein Family
UniProt Gene Name
FOLR3
UniProt Synonym Gene Names
FR-gamma
UniProt Entry Name
FOLR3_HUMAN

NCBI Description

This gene encodes a member of the folate receptor (FOLR) family, members of which have a high affinity for folic acid and for several reduced folic acid derivatives, and mediate delivery of 5-methyltetrahydrofolate to the interior of cells. This gene includes two polymorphic variants; the shorter one has two base deletion in the CDS, resulting in a truncated polypeptide, compared to the longer one. Both protein products are constitutively secreted in hematopoietic tissues and are potential serum marker for certain hematopoietic malignancies. The longer protein has a 71% and 79% sequence homology with the FOLR1 and FOLR2 proteins, respectively. [provided by RefSeq, Jul 2008]

Uniprot Description

FOLR3: Binds to folate and reduced folic acid derivatives and mediates delivery of 5-methyltetrahydrofolate to the interior of cells. Isoform Short does not bind folate. Belongs to the folate receptor family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 11q13

Cellular Component: extrinsic to membrane; membrane; extracellular region

Molecular Function: folic acid binding

Biological Process: folic acid transport

Research Articles on FOLR3

Similar Products

Product Notes

The FOLR3 folr3 (Catalog #AAA6006059) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FOLR3 (Folate Receptor gamma, FR-gamma, Folate Receptor 3) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FOLR3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the FOLR3 folr3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MDMAWQMMQL LLLALVTAAG SAQPRSARAR TDLLNVCMNA KHHKTQPSPE DELYGQCSPW KKNACCTAST SQELHKDTSR LYNFNWDHCG KMEPTCKRHF IQDSCLYECS PNLGPWIRQV NQSWRKERIL NVPLCKEDCE RWWEDCRTSY TCKSNWHKGW NWTSGINECP AGALCSTFES YFPTPAALCE GLWSHSFKVS NYSRGSGRCI QMWFDSAQGN PNEEVAKFYA AAMNAGAPSR GIIDS. It is sometimes possible for the material contained within the vial of "FOLR3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.