Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of FOLR1 expression in transfected 293T cell line by FOLR1 polyclonal antibody. Lane 1: FOLR1 transfected lysate (29.8kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human FOLR1 Polyclonal Antibody | anti-FOLR1 antibody

FOLR1 (Folate Receptor alpha, FR-alpha, Adult Folate-binding Protein, FBP, Folate Receptor 1, Folate Receptor, Adult, KB cells FBP, Ovarian Tumor-associated Antigen MOv18, FOLR) (FITC)

Gene Names
FOLR1; FBP; FOLR
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
FOLR1; Polyclonal Antibody; FOLR1 (Folate Receptor alpha; FR-alpha; Adult Folate-binding Protein; FBP; Folate Receptor 1; Folate Receptor; Adult; KB cells FBP; Ovarian Tumor-associated Antigen MOv18; FOLR) (FITC); anti-FOLR1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human FOLR1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein Isothiocyanate (FITC).
Applicable Applications for anti-FOLR1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human FOLR1, aa1-257 (NP_000793.1).
Immunogen Sequence
MAQRMTTQLLLLLVWVAVVGEAQTRIAWARTELLNVCMNAKHHKEKPGPEDKLHEQCRPWRKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMAPACKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERVLNVPLCKEDCEQWWEDCRTSYTCKSNWHKGWNWTSGFNKCAVGAACQPFHFYFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAAAMSGAGPWAAWPFLLSLALMLLWLLS
Conjugate
FITC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of FOLR1 expression in transfected 293T cell line by FOLR1 polyclonal antibody. Lane 1: FOLR1 transfected lysate (29.8kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of FOLR1 expression in transfected 293T cell line by FOLR1 polyclonal antibody. Lane 1: FOLR1 transfected lysate (29.8kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-FOLR1 antibody
Folate receptor 1 (FOLR1; also folate receptor alpha, folate binding protein 1, and MOv18) is a 37-42kD member of the folate receptor family. FOLR1 is expressed in reticulocytes and placenta, plus renal, mammary, and thymic epithelium, where it mediates the transport of 5-methyltetrahydrofolate into the cell. The human FOLR1 preproprecursor is 257aa in length. It codes for a GPI-linked glycoprotein that is 210aa in size (aa25-234). There are two forms of FOLR1. One is GPI-linked, while the other is a soluble MMP cleavage product (aa25-226). There is one potential alternate splice form that shows a five aa substitution for aa121-205. Over aa25-233, human FOLR1 shares 83% aa identity with mouse FOLR1.
Product Categories/Family for anti-FOLR1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29,819 Da
NCBI Official Full Name
folate receptor alpha
NCBI Official Synonym Full Names
folate receptor 1 (adult)
NCBI Official Symbol
FOLR1
NCBI Official Synonym Symbols
FBP; FOLR
NCBI Protein Information
folate receptor alpha; FR-alpha; KB cells FBP; folate binding protein; folate receptor, adult; adult folate-binding protein; ovarian tumor-associated antigen MOv18
UniProt Protein Name
Folate receptor alpha
Protein Family
UniProt Gene Name
FOLR1
UniProt Synonym Gene Names
FOLR; FR-alpha; FBP
UniProt Entry Name
FOLR1_HUMAN

NCBI Description

The protein encoded by this gene is a member of the folate receptor family. Members of this gene family bind folic acid and its reduced derivatives, and transport 5-methyltetrahydrofolate into cells. This gene product is a secreted protein that either anchors to membranes via a glycosyl-phosphatidylinositol linkage or exists in a soluble form. Mutations in this gene have been associated with neurodegeneration due to cerebral folate transport deficiency. Due to the presence of two promoters, multiple transcription start sites, and alternative splicing, multiple transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Oct 2009]

Uniprot Description

FOLR1: Binds to folate and reduced folic acid derivatives and mediates delivery of 5-methyltetrahydrofolate to the interior of cells. Defects in FOLR1 are the cause of neurodegeneration due to cerebral folate transport deficiency (NCFTD). NCFTD is an autosomal recessive disorder resulting from brain- specific folate deficiency early in life. Onset is apparent in late infancy with severe developmental regression, movement disturbances, epilepsy, and leukodystrophy. Recognition and diagnosis of this disorder is critical because folinic acid therapy can reverse the clinical symptoms and improve brain abnormalities and function. Belongs to the folate receptor family.

Protein type: Membrane protein, GPI anchor

Chromosomal Location of Human Ortholog: 11q13.3-q14.1

Cellular Component: anchored to external side of plasma membrane; cell surface; membrane; clathrin-coated vesicle; brush border membrane; integral to plasma membrane; apical plasma membrane; plasma membrane; endosome

Molecular Function: folic acid transporter activity; receptor activity; folic acid binding

Biological Process: receptor-mediated endocytosis; folic acid metabolic process; folic acid transport

Disease: Neurodegeneration Due To Cerebral Folate Transport Deficiency

Research Articles on FOLR1

Similar Products

Product Notes

The FOLR1 folr1 (Catalog #AAA6378793) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FOLR1 (Folate Receptor alpha, FR-alpha, Adult Folate-binding Protein, FBP, Folate Receptor 1, Folate Receptor, Adult, KB cells FBP, Ovarian Tumor-associated Antigen MOv18, FOLR) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FOLR1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the FOLR1 folr1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FOLR1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.