Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: FN1Sample Tissue: Human Ovary TumorAntibody Dilution: 1.0ug/ml)

Rabbit FN1 Polyclonal Antibody | anti-FN1 antibody

FN1 antibody - C-terminal region

Gene Names
FN1; FN; CIG; FNZ; MSF; ED-B; FINC; GFND; LETS; GFND2; SMDCF
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Applications
Western Blot
Purity
Affinity Purified
Synonyms
FN1; Polyclonal Antibody; FN1 antibody - C-terminal region; anti-FN1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NCRRPGGEPSPEGTTGQSYNQYSQRYHQRTNTNVNCPIECFMPLDVQADR
Sequence Length
693
Applicable Applications for anti-FN1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 77%; Horse: 93%; Human: 100%; Mouse: 85%; Pig: 100%; Rabbit: 93%; Rat: 93%; Sheep: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human FN1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: FN1Sample Tissue: Human Ovary TumorAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: FN1Sample Tissue: Human Ovary TumorAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(WB Suggested Anti-FN1 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysate)

Western Blot (WB) (WB Suggested Anti-FN1 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysate)
Related Product Information for anti-FN1 antibody
This is a rabbit polyclonal antibody against FN1. It was validated on Western Blot

Target Description: FN1 is a glycoprotein present in a soluble dimeric form in plasma, and in a dimeric or multimeric form at the cell surface and in extracellular matrix. Fibronectin is involved in cell adhesion and migration processes including embryogenesis, wound healing, blood coagulation, host defense, and metastasis.
Product Categories/Family for anti-FN1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
76kDa
NCBI Official Full Name
fibronectin 1, isoform CRA_e
NCBI Official Synonym Full Names
fibronectin 1
NCBI Official Symbol
FN1
NCBI Official Synonym Symbols
FN; CIG; FNZ; MSF; ED-B; FINC; GFND; LETS; GFND2; SMDCF
NCBI Protein Information
fibronectin
UniProt Protein Name
Fibronectin
Protein Family
UniProt Gene Name
FN1
UniProt Synonym Gene Names
FN; FN; CIG
UniProt Entry Name
FINC_HUMAN

NCBI Description

This gene encodes fibronectin, a glycoprotein present in a soluble dimeric form in plasma, and in a dimeric or multimeric form at the cell surface and in extracellular matrix. The encoded preproprotein is proteolytically processed to generate the mature protein. Fibronectin is involved in cell adhesion and migration processes including embryogenesis, wound healing, blood coagulation, host defense, and metastasis. The gene has three regions subject to alternative splicing, with the potential to produce 20 different transcript variants, at least one of which encodes an isoform that undergoes proteolytic processing. The full-length nature of some variants has not been determined. [provided by RefSeq, Jan 2016]

Uniprot Description

FN1: Fibronectins bind cell surfaces and various compounds including collagen, fibrin, heparin, DNA, and actin. Fibronectins are involved in cell adhesion, cell motility, opsonization, wound healing, and maintenance of cell shape. Defects in FN1 are the cause of glomerulopathy with fibronectin deposits type 2 (GFND2); also known as familial glomerular nephritis with fibronectin deposits or fibronectin glomerulopathy. GFND is a genetically heterogeneous autosomal dominant disorder characterized clinically by proteinuria, microscopic hematuria, and hypertension that leads to end-stage renal failure in the second to fifth decade of life. 15 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted; Secreted, signal peptide; Motility/polarity/chemotaxis; Cell adhesion

Chromosomal Location of Human Ortholog: 2q34

Cellular Component: extracellular matrix; extracellular space; apical plasma membrane; fibrinogen complex; extracellular region; ER-Golgi intermediate compartment; basal lamina

Molecular Function: heparin binding; collagen binding; integrin binding; protein binding; protease activator activity; protease binding

Biological Process: integrin activation; platelet activation; extracellular matrix organization and biogenesis; positive regulation of axon extension; extracellular matrix disassembly; regulation of cell shape; platelet degranulation; acute-phase response; calcium-independent cell-matrix adhesion; cell-substrate junction assembly; response to wounding; peptide cross-linking; angiogenesis; cell adhesion; blood coagulation; leukocyte migration

Disease: Glomerulopathy With Fibronectin Deposits 2; Plasma Fibronectin Deficiency

Research Articles on FN1

Similar Products

Product Notes

The FN1 fn1 (Catalog #AAA3205882) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FN1 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's FN1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the FN1 fn1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NCRRPGGEPS PEGTTGQSYN QYSQRYHQRT NTNVNCPIEC FMPLDVQADR. It is sometimes possible for the material contained within the vial of "FN1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.