Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: FLT1Sample Type: HepG2 Whole Cell lysatesAntibody Dilution: 1.0ug/mlThere is BioGPS gene expression data showing that FLT1 is expressed in HepG2)

Rabbit FLT1 Polyclonal Antibody | anti-FLT1 antibody

FLT1 Antibody - C-terminal region

Gene Names
FLT1; FLT; FLT-1; VEGFR1; VEGFR-1
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
FLT1; Polyclonal Antibody; FLT1 Antibody - C-terminal region; anti-FLT1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DLRVTSKSKESGLSDVSRPSFCHSSCGHVSEGKRRFTYDHAELERKIACC
Sequence Length
463
Applicable Applications for anti-FLT1 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 100%; Goat: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Rabbit: 77%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human FLT1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: FLT1Sample Type: HepG2 Whole Cell lysatesAntibody Dilution: 1.0ug/mlThere is BioGPS gene expression data showing that FLT1 is expressed in HepG2)

Western Blot (WB) (Host: RabbitTarget Name: FLT1Sample Type: HepG2 Whole Cell lysatesAntibody Dilution: 1.0ug/mlThere is BioGPS gene expression data showing that FLT1 is expressed in HepG2)
Related Product Information for anti-FLT1 antibody
This is a rabbit polyclonal antibody against FLT1. It was validated on Western Blot

Target Description: This gene encodes a member of the vascular endothelial growth factor receptor (VEGFR) family. VEGFR family members are receptor tyrosine kinases (RTKs) which contain an extracellular ligand-binding region with seven immunoglobulin (Ig)-like domains, a transmembrane segment, and a tyrosine kinase (TK) domain within the cytoplasmic domain. This protein binds to VEGFR-A, VEGFR-B and placental growth factor and plays an important role in angiogenesis and vasculogenesis. Expression of this receptor is found in vascular endothelial cells, placental trophoblast cells and peripheral blood monocytes. Multiple transcript variants encoding different isoforms have been found for this gene. Isoforms include a full-length transmembrane receptor isoform and shortened, soluble isoforms. The soluble isoforms are associated with the onset of pre-eclampsia.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
50kDa
NCBI Official Full Name
vascular endothelial growth factor receptor 1 isoform 2
NCBI Official Synonym Full Names
fms related tyrosine kinase 1
NCBI Official Symbol
FLT1
NCBI Official Synonym Symbols
FLT; FLT-1; VEGFR1; VEGFR-1
NCBI Protein Information
vascular endothelial growth factor receptor 1
UniProt Protein Name
Vascular endothelial growth factor receptor 1
UniProt Gene Name
FLT1
UniProt Synonym Gene Names
FLT; FRT; VEGFR1; VEGFR-1; FLT-1; FLT
UniProt Entry Name
VGFR1_HUMAN

NCBI Description

This gene encodes a member of the vascular endothelial growth factor receptor (VEGFR) family. VEGFR family members are receptor tyrosine kinases (RTKs) which contain an extracellular ligand-binding region with seven immunoglobulin (Ig)-like domains, a transmembrane segment, and a tyrosine kinase (TK) domain within the cytoplasmic domain. This protein binds to VEGFR-A, VEGFR-B and placental growth factor and plays an important role in angiogenesis and vasculogenesis. Expression of this receptor is found in vascular endothelial cells, placental trophoblast cells and peripheral blood monocytes. Multiple transcript variants encoding different isoforms have been found for this gene. Isoforms include a full-length transmembrane receptor isoform and shortened, soluble isoforms. The soluble isoforms are associated with the onset of pre-eclampsia.[provided by RefSeq, May 2009]

Uniprot Description

VEGFR1: a receptor tyrosine kinase of the VEGFR family. Receptor for VEGF, VEGFB and PGF. The VEGF-kinase ligand/receptor signaling system plays a key role in vascular development and regulation of vascular permeability. Two splice variant isoforms have been described. Isoform SFlt1 may have an inhibitory role in angiogenesis.

Protein type: Protein kinase, TK; Membrane protein, integral; Kinase, protein; Protein kinase, tyrosine (receptor); EC 2.7.10.1; TK group; VEGFR family

Chromosomal Location of Human Ortholog: 13q12

Cellular Component: extracellular space; focal adhesion; integral to plasma membrane; plasma membrane; receptor complex; endosome

Molecular Function: vascular endothelial growth factor receptor activity; identical protein binding; protein binding; growth factor binding; transmembrane receptor protein tyrosine kinase activity; ATP binding

Biological Process: cell migration; peptidyl-tyrosine phosphorylation; protein amino acid autophosphorylation; positive regulation of phosphoinositide 3-kinase activity; positive regulation of vascular endothelial growth factor receptor signaling pathway; patterning of blood vessels; positive regulation of phosphoinositide 3-kinase cascade; positive regulation of MAP kinase activity; monocyte chemotaxis; positive regulation of angiogenesis; positive regulation of MAPKKK cascade; positive regulation of cell proliferation; blood vessel morphogenesis; sprouting angiogenesis; embryonic morphogenesis; cell differentiation; vascular endothelial growth factor receptor signaling pathway; transmembrane receptor protein tyrosine kinase signaling pathway; positive regulation of cell migration

Research Articles on FLT1

Similar Products

Product Notes

The FLT1 flt1 (Catalog #AAA3215053) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FLT1 Antibody - C-terminal region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's FLT1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the FLT1 flt1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DLRVTSKSKE SGLSDVSRPS FCHSSCGHVS EGKRRFTYDH AELERKIACC. It is sometimes possible for the material contained within the vial of "FLT1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.