Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-FKBP14 AntibodyTitration: 1.0 ug/mlPositive Control: Hela Whole CellFKBP14 is supported by BioGPS gene expression data to be expressed in HeLa)

Rabbit FKBP14 Polyclonal Antibody | anti-FKBP14 antibody

FKBP14 antibody - middle region

Gene Names
FKBP14; EDSKMH; FKBP22; IPBP12; EDSKSCL2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
FKBP14; Polyclonal Antibody; FKBP14 antibody - middle region; anti-FKBP14 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GLKGMCVGEKRKLIIPPALGYGKEGKGKIPPESTLIFNIDLLEIRNGPRS
Sequence Length
211
Applicable Applications for anti-FKBP14 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-FKBP14 AntibodyTitration: 1.0 ug/mlPositive Control: Hela Whole CellFKBP14 is supported by BioGPS gene expression data to be expressed in HeLa)

Western Blot (WB) (WB Suggested Anti-FKBP14 AntibodyTitration: 1.0 ug/mlPositive Control: Hela Whole CellFKBP14 is supported by BioGPS gene expression data to be expressed in HeLa)
Related Product Information for anti-FKBP14 antibody
This is a rabbit polyclonal antibody against FKBP14. It was validated on Western Blot

Target Description: PPIases accelerate the folding of proteins during protein synthesis.
Product Categories/Family for anti-FKBP14 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23kDa
NCBI Official Full Name
peptidyl-prolyl cis-trans isomerase FKBP14
NCBI Official Synonym Full Names
FKBP prolyl isomerase 14
NCBI Official Symbol
FKBP14
NCBI Official Synonym Symbols
EDSKMH; FKBP22; IPBP12; EDSKSCL2
NCBI Protein Information
peptidyl-prolyl cis-trans isomerase FKBP14
UniProt Protein Name
Peptidyl-prolyl cis-trans isomerase FKBP14
UniProt Gene Name
FKBP14
UniProt Synonym Gene Names
FKBP22; PPIase FKBP14; 22 kDa FKBP; FKBP-22; FKBP-14
UniProt Entry Name
FKB14_HUMAN

NCBI Description

The protein encoded by this gene is a member of the FK506-binding protein family of peptidyl-prolyl cis-trans isomerases. The encoded protein is found in the lumen of the endoplasmic reticulum, where it is thought to accelerate protein folding. Defects in this gene are a cause of a type of Ehlers-Danlos syndrome (EDS). Both a protein-coding variant and noncoding variants are transcribed from this gene. [provided by RefSeq, Mar 2012]

Uniprot Description

FKBP14: PPIases accelerate the folding of proteins during protein synthesis. Defects in FKBP14 are the cause of Ehlers-Danlos syndrome with progressive kyphoscoliosis, myopathy, and hearing loss (EDSKMH). A syndrome with features of Ehlers-Danlos syndrome types VIA and VIB on the one hand, and the collagen VI- related congenital myopathies Ullrich congenital muscular dystrophy and Bethlem myopathy on the other hand. Clinically, this disorder is characterized by the following features: severe generalized hypotonia at birth with marked muscle weakness that improve in infancy; early-onset progressive kyphoscoliosis; joint hypermobility without contractures; hyperelastic skin with follicular hyperkeratosis, easy bruising, and occasional abnormal scarring; myopathy as confirmed by muscle MRI, histology, and electron microscopy; hearing impairment, which is predominantly sensorineural; and a normal ratio of lysyl pyridinoline to hydroxylysyl pyridinoline (LP/HP) in urine.

Protein type: Secreted, signal peptide; Secreted; Isomerase; EC 5.2.1.8

Chromosomal Location of Human Ortholog: 7p14.3

Cellular Component: endoplasmic reticulum membrane; endoplasmic reticulum lumen

Molecular Function: FK506 binding; peptidyl-prolyl cis-trans isomerase activity; calcium ion binding

Biological Process: protein peptidyl-prolyl isomerization; unfolded protein response, activation of signaling protein activity; cellular protein metabolic process; unfolded protein response

Disease: Ehlers-danlos Syndrome With Progressive Kyphoscoliosis, Myopathy, And Hearing Loss

Research Articles on FKBP14

Similar Products

Product Notes

The FKBP14 fkbp14 (Catalog #AAA3215692) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FKBP14 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's FKBP14 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the FKBP14 fkbp14 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GLKGMCVGEK RKLIIPPALG YGKEGKGKIP PESTLIFNID LLEIRNGPRS. It is sometimes possible for the material contained within the vial of "FKBP14, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.