Western Blot (WB)
(Host: RabbitTarget Name: FIG4Sample Tissue: Human Hela Whole Cell lysatesAntibody Dilution: 1ug/ml)
Rabbit anti-Human FIG4 Polyclonal Antibody | anti-FIG4 antibody
FIG4 Antibody-C-terminal region
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
FIG4; Polyclonal Antibody; FIG4 Antibody-C-terminal region; Polyphosphoinositide phosphatase; UBC; VAC14; YVS; BTOP; SAC3; ALS11; CMT4J; KIAA0274; dJ249I4.1; anti-FIG4 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100ul at 0.5-1mg/ml (varies by lot)
Sequence
PISAFSQDNIYEVQPPRVDRKSTEIFQAHIQASQGIMQPLGKEDSSMYRE
Applicable Applications for anti-FIG4 antibody
Western Blot (WB)
Protein Size
907 amino acids
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human FIG4
Predicted Homology Based on Immunogen Sequence
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: FIG4Sample Tissue: Human Hela Whole Cell lysatesAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: FIG4Sample Tissue: Human Hela Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-FIG4 antibody
Description of Target: The protein encoded by this gene belongs to the SAC domain-containing protein gene family. The SAC domain, approximately 400 amino acids in length and consisting of seven conserved motifs, has been shown to possess phosphoinositide phosphatase activity. The yeast homolog, Sac1p, is involved in the regulation of various phosphoinositides, and affects diverse cellular functions such as actin cytoskeleton organization, Golgi function, and maintenance of vacuole morphology. Membrane-bound phosphoinositides function as signaling molecules and play a key role in vesicle trafficking in eukaryotic cells. Mutations in this gene have been associated with Charcot-Marie-Tooth disease, type 4J.
NCBI and Uniprot Product Information
NCBI GeneID
Molecular Weight
104kDa
UniProt Protein Name
Polyphosphoinositide phosphatase
Protein Family
UniProt Gene Name
FIG4
UniProt Synonym Gene Names
KIAA0274; SAC3
UniProt Entry Name
FIG4_HUMAN
Similar Products
Product Notes
The FIG4 fig4 (Catalog #AAA3249620) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FIG4 Antibody-C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FIG4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the FIG4 fig4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: PISAFSQDNI YEVQPPRVDR KSTEIFQAHI QASQGIMQPL GKEDSSMYRE. It is sometimes possible for the material contained within the vial of "FIG4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
