Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Fibronectin 1 antibody (MBS5301825) used at 1 ug/ml to detect target protein.)

Rabbit Fibronectin 1 Polyclonal Antibody | anti-FN1 antibody

Fibronectin 1 antibody

Gene Names
FN1; FN; CIG; FNZ; MSF; ED-B; FINC; GFND; LETS; GFND2
Applications
Western Blot
Purity
Affinity purified
Synonyms
Fibronectin 1; Polyclonal Antibody; Fibronectin 1 antibody; Polyclonal Fibronectin 1; Anti-Fibronectin 1; MSF; DKFZp686I1370; DKFZp686O13149; FINC; FN; CIG; LETS; DKFZp686F10164; FN1; DKFZp686H0342; anti-FN1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Clonality
Polyclonal
Specificity
Fibronectin 1 antibody was raised against the N terminal of FN1
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FN1 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
2265
Applicable Applications for anti-FN1 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
FN1 is a glycoprotein present in a soluble dimeric form in plasma, and in a dimeric or multimeric form at the cell surface and in extracellular matrix. Fibronectin is involved in cell adhesion and migration processes including embryogenesis and wound healing.
Cross-Reactivity
Human
Immunogen
Fibronectin 1 antibody was raised using the N terminal of FN1 corresponding to a region with amino acids GNALVCTCYGGSRGFNCESKPEAEETCFDKYTGNTYRVGDTYERPKDSMI
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(Fibronectin 1 antibody (MBS5301825) used at 1 ug/ml to detect target protein.)

Western Blot (WB) (Fibronectin 1 antibody (MBS5301825) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-FN1 antibody
Rabbit polyclonal Fibronectin 1 antibody raised against the N terminal of FN1
Product Categories/Family for anti-FN1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
71 kDa (MW of target protein)
NCBI Official Full Name
fibronectin 1
NCBI Official Synonym Full Names
fibronectin 1
NCBI Official Symbol
FN1
NCBI Official Synonym Symbols
FN; CIG; FNZ; MSF; ED-B; FINC; GFND; LETS; GFND2
NCBI Protein Information
fibronectin
UniProt Protein Name
Fibronectin
Protein Family
UniProt Gene Name
FN1
UniProt Synonym Gene Names
FN; FN; CIG
UniProt Entry Name
FINC_HUMAN

NCBI Description

This gene encodes fibronectin, a glycoprotein present in a soluble dimeric form in plasma, and in a dimeric or multimeric form at the cell surface and in extracellular matrix. Fibronectin is involved in cell adhesion and migration processes including embryogenesis, wound healing, blood coagulation, host defense, and metastasis. The gene has three regions subject to alternative splicing, with the potential to produce 20 different transcript variants. However, the full-length nature of some variants has not been determined. [provided by RefSeq, Jul 2008]

Uniprot Description

FN1: Fibronectins bind cell surfaces and various compounds including collagen, fibrin, heparin, DNA, and actin. Fibronectins are involved in cell adhesion, cell motility, opsonization, wound healing, and maintenance of cell shape. Defects in FN1 are the cause of glomerulopathy with fibronectin deposits type 2 (GFND2); also known as familial glomerular nephritis with fibronectin deposits or fibronectin glomerulopathy. GFND is a genetically heterogeneous autosomal dominant disorder characterized clinically by proteinuria, microscopic hematuria, and hypertension that leads to end-stage renal failure in the second to fifth decade of life. 15 isoforms of the human protein are produced by alternative splicing.

Protein type: Motility/polarity/chemotaxis; Secreted; Cell adhesion; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 2q34

Cellular Component: extracellular matrix; extracellular space; fibrinogen complex; apical plasma membrane; ER-Golgi intermediate compartment; extracellular region; basal lamina

Molecular Function: collagen binding; heparin binding; integrin binding; protein binding; protease activator activity; protease binding

Biological Process: integrin activation; platelet activation; extracellular matrix organization and biogenesis; positive regulation of axon extension; extracellular matrix disassembly; regulation of cell shape; platelet degranulation; cell-substrate junction assembly; acute-phase response; response to wounding; calcium-independent cell-matrix adhesion; peptide cross-linking; angiogenesis; blood coagulation; cell adhesion; leukocyte migration

Disease: Glomerulopathy With Fibronectin Deposits 2; Plasma Fibronectin Deficiency

Research Articles on FN1

Similar Products

Product Notes

The FN1 fn1 (Catalog #AAA5301825) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Fibronectin 1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the FN1 fn1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Fibronectin 1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.