Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of FGFR1OP expression in transfected 293T cell line by FGFR1OP polyclonal antibody. Lane 1: FGFR1OP transfected lysate (43.89kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human FGFR1OP Polyclonal Antibody | anti-FGFR1OP antibody

FGFR1OP (FGFR1 Oncogene Partner, FOP)

Gene Names
FGFR1OP; FOP
Reactivity
Human
Applications
Western Blot, Immunofluorescence
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
FGFR1OP; Polyclonal Antibody; FGFR1OP (FGFR1 Oncogene Partner; FOP); Anti -FGFR1OP (FGFR1 Oncogene Partner; anti-FGFR1OP antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human FGFR1OP.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MAATAAAVVAEEDTELRDLLVQTLENSGVLNRIKAELRAAVFLALEEQEKVENKTPLVNESLKKFLNTKDGRLVASLVAEFLQFFNLDFTLAVFQPETSTLQGLEGRENLARDLGIIEAEGTVGGPLLLEVIRRCQQKEKGPTTGEGALDLSDVHSPPKSPEGKTSAQTTPSKIPRYKGQGKKKTSGQKAGDKKANDEANQSDTSVSLSEPKSKSSLHLLSHETKIGSFLSNRTLDGKDKAGLCPDEDDMEGDSFFDDPIPKPEKTYGLRKEPRKQAGSLASLSDAPPLKSGLSSLAGAPSLKDSESKRGNTVLKDLKLISDKIGSLGLGTGEDDDYVDDFNSTSHRSEKSEISIGEEIEEDLSVEIDDINTSDKLDDLTQDLTVSQLSDVADYLEDVA
Applicable Applications for anti-FGFR1OP antibody
Western Blot (WB), Immunofluorescence (IF)
Application Notes
Suitable for use in Immunofluorescence and Western Blot.
Dilution: Immunofluorescence: 10ug/ml
Immunogen
Full length human FGFR1OP, aa1-399 (NP_008976.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of FGFR1OP expression in transfected 293T cell line by FGFR1OP polyclonal antibody. Lane 1: FGFR1OP transfected lysate (43.89kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of FGFR1OP expression in transfected 293T cell line by FGFR1OP polyclonal antibody. Lane 1: FGFR1OP transfected lysate (43.89kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of purified antibody to FGFR1OP on HeLa cell. [antibody concentration 10ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of purified antibody to FGFR1OP on HeLa cell. [antibody concentration 10ug/ml].)
Related Product Information for anti-FGFR1OP antibody
Required for anchoring microtubules to the centrosomes.
Product Categories/Family for anti-FGFR1OP antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43,065 Da
NCBI Official Full Name
FGFR1 oncogene partner isoform a
NCBI Official Synonym Full Names
FGFR1 oncogene partner
NCBI Official Symbol
FGFR1OP
NCBI Official Synonym Symbols
FOP
NCBI Protein Information
FGFR1 oncogene partner; fibroblast growth factor receptor 1 oncogene partner
UniProt Protein Name
FGFR1 oncogene partner
Protein Family
UniProt Gene Name
FGFR1OP
UniProt Synonym Gene Names
FOP
UniProt Entry Name
FR1OP_HUMAN

NCBI Description

This gene encodes a largely hydrophilic centrosomal protein that is required for anchoring microtubules to subcellular structures. A t(6;8)(q27;p11) chromosomal translocation, fusing this gene and the fibroblast growth factor receptor 1 (FGFR1) gene, has been found in cases of myeloproliferative disorder. The resulting chimeric protein contains the N-terminal leucine-rich region of this encoded protein fused to the catalytic domain of FGFR1. Alterations in this gene may also be associated with Crohn's disease, Graves' disease, and vitiligo. Alternatively spliced transcript variants that encode different proteins have been identified. [provided by RefSeq, Jul 2013]

Uniprot Description

FOP: Required for anchoring microtubules to the centrosomes. A chromosomal aberration involving FGFR1OP may be a cause of stem cell myeloproliferative disorder (MPD). Translocation t(6;8)(q27;p11) with FGFR1. MPD is characterized by myeloid hyperplasia, eosinophilia and T-cell or B-cell lymphoblastic lymphoma. In general it progresses to acute myeloid leukemia. The fusion proteins FGFR1OP-FGFR1 or FGFR1-FGFR1OP may exhibit constitutive kinase activity and be responsible for the transforming activity. Belongs to the FGFR1OP family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Unknown function

Chromosomal Location of Human Ortholog: 6q27

Cellular Component: centrosome; perinuclear region of cytoplasm; nucleus; cytosol

Molecular Function: protein tyrosine kinase inhibitor activity; protein binding; protein homodimerization activity; protein-tyrosine kinase activity; protein kinase binding

Biological Process: peptidyl-tyrosine phosphorylation; organelle organization and biogenesis; positive regulation of cell proliferation; negative regulation of protein kinase activity; mitotic cell cycle; G2/M transition of mitotic cell cycle; positive regulation of cell growth; positive regulation of cell migration

Research Articles on FGFR1OP

Similar Products

Product Notes

The FGFR1OP fgfr1op (Catalog #AAA6005266) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The FGFR1OP (FGFR1 Oncogene Partner, FOP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FGFR1OP can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunofluorescence (IF). Suitable for use in Immunofluorescence and Western Blot. Dilution: Immunofluorescence: 10ug/ml. Researchers should empirically determine the suitability of the FGFR1OP fgfr1op for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAATAAAVVA EEDTELRDLL VQTLENSGVL NRIKAELRAA VFLALEEQEK VENKTPLVNE SLKKFLNTKD GRLVASLVAE FLQFFNLDFT LAVFQPETST LQGLEGRENL ARDLGIIEAE GTVGGPLLLE VIRRCQQKEK GPTTGEGALD LSDVHSPPKS PEGKTSAQTT PSKIPRYKGQ GKKKTSGQKA GDKKANDEAN QSDTSVSLSE PKSKSSLHLL SHETKIGSFL SNRTLDGKDK AGLCPDEDDM EGDSFFDDPI PKPEKTYGLR KEPRKQAGSL ASLSDAPPLK SGLSSLAGAP SLKDSESKRG NTVLKDLKLI SDKIGSLGLG TGEDDDYVDD FNSTSHRSEK SEISIGEEIE EDLSVEIDDI NTSDKLDDLT QDLTVSQLSD VADYLEDVA. It is sometimes possible for the material contained within the vial of "FGFR1OP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.