Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: Fgfr1Sample Type: Mouse Liver lysatesAntibody Dilution: 1.0ug/ml)

Rabbit Fgfr1 Polyclonal Antibody | anti-FGFR1 antibody

Fgfr1 Antibody - N-terminal region

Gene Names
Fgfr1; FLG; MFR; Eask; Hspy; Flt-2; c-fgr; FGFR-I; Fgfr-1; AW208770; bFGF-R-1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Fgfr1; Polyclonal Antibody; Fgfr1 Antibody - N-terminal region; anti-FGFR1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TYFSVNVSDALPSSEDDDDDDDSSSEEKETDNTKPNRRPVAPYWTSPEKM
Sequence Length
822
Applicable Applications for anti-FGFR1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Fgfr1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: Fgfr1Sample Type: Mouse Liver lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: Fgfr1Sample Type: Mouse Liver lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-FGFR1 antibody
This is a rabbit polyclonal antibody against Fgfr1. It was validated on Western Blot

Target Description: Fgfr1 is a Tyrosine-protein kinase that acts as cell-surface receptor for fibroblast growth factors and plays an essential role in the regulation of embryonic development, cell proliferation, differentiation and migration. It is required for normal mesoderm patterning and correct axial organization during embryonic development, normal skeletogenesis and normal development of the gonadotropin-releasing hormone (GnRH) neuronal system. Fgfr1 phosphorylates PLCG1, FRS2, GAB1 and SHB. Ligand binding leads to the activation of several signaling cascades. Activation of PLCG1 leads to the production of the cellular signaling molecules diacylglycerol and inositol 1,4,5-trisphosphate. Phosphorylation of FRS2 triggers recruitment of GRB2, GAB1, PIK3R1 and SOS1, and mediates activation of RAS, MAPK1/ERK2, MAPK3/ERK1 and the MAP kinase signaling pathway, as well as of the AKT1 signaling pathway. It promotes phosphorylation of SHC1, STAT1 and PTPN11/SHP2. In the nucleus, Fgfr1 enhances RPS6KA1 and CREB1 activity and contributes to the regulation of transcription. FGFR1 signaling is down-regulated by IL17RD/SEF, and by FGFR1 ubiquitination, internalization and degradation

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
92kDa
NCBI Official Full Name
fibroblast growth factor receptor 1 isoform 1
NCBI Official Synonym Full Names
fibroblast growth factor receptor 1
NCBI Official Symbol
Fgfr1
NCBI Official Synonym Symbols
FLG; MFR; Eask; Hspy; Flt-2; c-fgr; FGFR-I; Fgfr-1; AW208770; bFGF-R-1
NCBI Protein Information
fibroblast growth factor receptor 1
UniProt Protein Name
Fibroblast growth factor receptor 1
Protein Family
UniProt Gene Name
Fgfr1
UniProt Synonym Gene Names
Flg; FGFR-1; bFGF-R-1
UniProt Entry Name
FGFR1_MOUSE

Uniprot Description

FGFR1: a receptor tyrosine kinase of the highly-conserved fibroblast growth factor receptor (FGFR). Binds both acidic and basic fibroblast growth factors and is involved in limb induction. Point mutations cause Pfeffer syndrome (finger and toe malformations and other skeletal errors) and dominant Kallmann syndrome 2. Stem cell leukemia lymphoma syndrome (SCLL) may be caused by a t(8;13)(p12;q12) translocation that fuses a zinc finger gene, ZNF198, to FGFR1. Various myeloproliferative disorders have been linked to translocations that fuse FGFR1 to FOP, FIM, CEP1 or the atypical kinase, Bcr. Inhibitor: SU5402. 20 isoforms of the human protein produced by alternative splicing have been described.

Protein type: Membrane protein, integral; Oncoprotein; Protein kinase, tyrosine (receptor); Kinase, protein; Protein kinase, TK; EC 2.7.10.1; TK group; FGFR family

Cellular Component: cytoplasm; cytoplasmic vesicle; integral to membrane; membrane; nucleus; perinuclear region of cytoplasm; plasma membrane; receptor complex

Molecular Function: ATP binding; cell adhesion molecule binding; fibroblast growth factor binding; fibroblast growth factor receptor activity; glycoprotein binding; heparin binding; identical protein binding; kinase activity; nucleotide binding; protein binding; protein complex binding; protein homodimerization activity; protein kinase activity; protein-tyrosine kinase activity; transferase activity; transmembrane receptor protein tyrosine kinase activity

Biological Process: angiogenesis; auditory receptor cell development; blood vessel morphogenesis; brain development; cell maturation; central nervous system neuron development; chondrocyte differentiation; embryonic limb morphogenesis; fibroblast growth factor receptor signaling pathway; generation of neurons; in utero embryonic development; induction of an organ; inner ear morphogenesis; lung development; mesenchymal cell differentiation; midbrain development; middle ear morphogenesis; motogenic signaling involved in postnatal olfactory bulb interneuron migration; negative regulation of osteoblast differentiation; negative regulation of transcription from RNA polymerase II promoter; neurite development; neuroblast division in the ventricular zone; orbitofrontal cortex development; outer ear morphogenesis; paraxial mesoderm development; peptidyl-tyrosine phosphorylation; phosphorylation; positive regulation of cardiac muscle cell proliferation; positive regulation of cell cycle; positive regulation of cell proliferation; positive regulation of MAP kinase activity; positive regulation of MAPKKK cascade; positive regulation of mesenchymal cell proliferation; positive regulation of neuron differentiation; positive regulation of transcription from RNA polymerase II promoter; protein amino acid autophosphorylation; protein amino acid phosphorylation; regulation of cell proliferation; regulation of gene expression; regulation of lateral mesodermal cell fate specification; regulation of phosphorus metabolic process; regulation of sensory perception of pain; salivary gland morphogenesis; sensory perception of sound; stem cell maintenance; ureteric bud development; vacuolar phosphate transport

Research Articles on FGFR1

Similar Products

Product Notes

The FGFR1 fgfr1 (Catalog #AAA3215870) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Fgfr1 Antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Fgfr1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the FGFR1 fgfr1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TYFSVNVSDA LPSSEDDDDD DDSSSEEKET DNTKPNRRPV APYWTSPEKM. It is sometimes possible for the material contained within the vial of "Fgfr1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.