Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (FGF1 rabbit polyclonal antibody. Western Blot analysis of FGF1 expression in human placenta.)

Rabbit anti-Human FGF1 Polyclonal Antibody | anti-FGF1 antibody

FGF1 (Fibroblast Growth Factor 1, FGF-1, Acidic Fibroblast Growth Factor, aFGF, Beta-endothelial Cell Growth Factor, ECGF-beta, Heparin-binding Growth Factor 1, HBGF-1, FGFA) (Biotin)

Gene Names
FGF1; AFGF; ECGF; FGFA; ECGFA; ECGFB; FGF-1; HBGF1; HBGF-1; GLIO703; ECGF-beta; FGF-alpha
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
FGF1; Polyclonal Antibody; FGF1 (Fibroblast Growth Factor 1; FGF-1; Acidic Fibroblast Growth Factor; aFGF; Beta-endothelial Cell Growth Factor; ECGF-beta; Heparin-binding Growth Factor 1; HBGF-1; FGFA) (Biotin); anti-FGF1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human FGF1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-FGF1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human FGF1, aa1-155 (NP_000791.1).
Immunogen Sequence
MAEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
Conjugate
Biotin
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(FGF1 rabbit polyclonal antibody. Western Blot analysis of FGF1 expression in human placenta.)

Western Blot (WB) (FGF1 rabbit polyclonal antibody. Western Blot analysis of FGF1 expression in human placenta.)

Western Blot (WB)

(Western Blot analysis of FGF1 expression in transfected 293T cell line by FGF1 polyclonal antibody. Lane 1: FGF1 transfected lysate (17.5kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of FGF1 expression in transfected 293T cell line by FGF1 polyclonal antibody. Lane 1: FGF1 transfected lysate (17.5kD). Lane 2: Non-transfected lysate.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between FGF1 and FGFR1 HeLa cells were stained with FGF1 rabbit purified polyclonal 1:1200 and FGFR1 mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Testing Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between FGF1 and FGFR1 HeLa cells were stained with FGF1 rabbit purified polyclonal 1:1200 and FGFR1 mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)
Related Product Information for anti-FGF1 antibody
Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. Functions as potent mitogen in vitro.
Product Categories/Family for anti-FGF1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
6,698 Da
NCBI Official Full Name
fibroblast growth factor 1 isoform 1
NCBI Official Synonym Full Names
fibroblast growth factor 1 (acidic)
NCBI Official Symbol
FGF1
NCBI Official Synonym Symbols
AFGF; ECGF; FGFA; ECGFA; ECGFB; FGF-1; HBGF1; HBGF-1; GLIO703; ECGF-beta; FGF-alpha
NCBI Protein Information
fibroblast growth factor 1; beta-endothelial cell growth factor; endothelial cell growth factor, alpha; endothelial cell growth factor, beta; heparin-binding growth factor 1
UniProt Protein Name
Fibroblast growth factor 1
Protein Family
UniProt Gene Name
FGF1
UniProt Synonym Gene Names
FGFA; FGF-1; aFGF; ECGF; HBGF-1
UniProt Entry Name
FGF1_HUMAN

NCBI Description

The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein functions as a modifier of endothelial cell migration and proliferation, as well as an angiogenic factor. It acts as a mitogen for a variety of mesoderm- and neuroectoderm-derived cells in vitro, thus is thought to be involved in organogenesis. Multiple alternatively spliced variants encoding different isoforms have been described. [provided by RefSeq, Jan 2009]

Uniprot Description

FGF1: Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. Functions as potent mitogen in vitro. Monomer. Homodimer. Interacts with FGFR1, FGFR2, FGFR3 and FGFR4. Affinity between fibroblast growth factors (FGFs) and their receptors is increased by heparan sulfate glycosaminoglycans that function as coreceptors. Found in a complex with FGFBP1, FGF1 and FGF2. Interacts with FGFBP1. Part of a Cu(2+)-dependent multiprotein aggregate containing FGF1, S100A13 and SYT1. Interacts with SYT1. Interacts with S100A13. Belongs to the heparin-binding growth factors family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Motility/polarity/chemotaxis; Cell development/differentiation; Cytokine

Chromosomal Location of Human Ortholog: 5q31

Cellular Component: nucleoplasm; extracellular space; proteinaceous extracellular matrix; extracellular region; nucleolus; cell cortex; cytosol

Molecular Function: heparin binding; protein binding; growth factor activity; Hsp70 protein binding; fibroblast growth factor receptor binding

Biological Process: epidermal growth factor receptor signaling pathway; anatomical structure morphogenesis; phosphoinositide-mediated signaling; fibroblast growth factor receptor signaling pathway; nerve growth factor receptor signaling pathway; multicellular organismal development; positive regulation of cholesterol biosynthetic process; signal transduction; positive regulation of MAP kinase activity; positive regulation of angiogenesis; induction of an organ; positive regulation of cell division; positive regulation of cell proliferation; insulin receptor signaling pathway; innate immune response; positive regulation of transcription from RNA polymerase II promoter; angiogenesis; positive regulation of epithelial cell proliferation; lung development; positive regulation of cell migration

Research Articles on FGF1

Similar Products

Product Notes

The FGF1 fgf1 (Catalog #AAA6378462) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FGF1 (Fibroblast Growth Factor 1, FGF-1, Acidic Fibroblast Growth Factor, aFGF, Beta-endothelial Cell Growth Factor, ECGF-beta, Heparin-binding Growth Factor 1, HBGF-1, FGFA) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FGF1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the FGF1 fgf1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FGF1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.