Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-Fgf1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Rat Kidney)

Rabbit Fgf1 Polyclonal Antibody | anti-FGF1 antibody

Fgf1 antibody - N-terminal region

Gene Names
Fgf1; FGF-1; HBGF1; HBGF-1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Fgf1; Polyclonal Antibody; Fgf1 antibody - N-terminal region; anti-FGF1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MAEGEITTFAALTERFNLPLGNYKKPKLLYCSNGGHFLRILPDGTVDGTR
Sequence Length
155
Applicable Applications for anti-FGF1 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 86%; Pig: 100%; Rabbit: 93%; Rat: 100%; Sheep: 86%
Immunogen
The immunogen is a synthetic peptide corresponding to a region of Rat
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-Fgf1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Rat Kidney)

Western Blot (WB) (WB Suggested Anti-Fgf1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Rat Kidney)
Related Product Information for anti-FGF1 antibody
This is a rabbit polyclonal antibody against Fgf1. It was validated on Western Blot

Target Description: The heparin-binding growth factors are angiogenic agents in vivo and are potent mitogens for a variety of cell types in vitro. There are differences in the tissue distribution and concentration of these 2 growth factors.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
17kDa
NCBI Official Full Name
fibroblast growth factor 1
NCBI Official Synonym Full Names
fibroblast growth factor 1
NCBI Official Symbol
Fgf1
NCBI Official Synonym Symbols
FGF-1; HBGF1; HBGF-1
NCBI Protein Information
fibroblast growth factor 1
UniProt Protein Name
Fibroblast growth factor 1
Protein Family
UniProt Gene Name
Fgf1
UniProt Synonym Gene Names
Fgf-1; Fgfa; FGF-1; aFGF; HBGF-1
UniProt Entry Name
FGF1_RAT

NCBI Description

may play a role in neurite outgrowth; may regulate cell differentiation in the nervous system; may act in synergy with fibronectin to enhance neuronal cell adhesion [RGD, Feb 2006]

Uniprot Description

FGF1: Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. Functions as potent mitogen in vitro. Monomer. Homodimer. Interacts with FGFR1, FGFR2, FGFR3 and FGFR4. Affinity between fibroblast growth factors (FGFs) and their receptors is increased by heparan sulfate glycosaminoglycans that function as coreceptors. Found in a complex with FGFBP1, FGF1 and FGF2. Interacts with FGFBP1. Part of a Cu(2+)-dependent multiprotein aggregate containing FGF1, S100A13 and SYT1. Interacts with SYT1. Interacts with S100A13. Belongs to the heparin-binding growth factors family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell development/differentiation; Motility/polarity/chemotaxis; Cytokine

Cellular Component: nucleoplasm; proteinaceous extracellular matrix; extracellular space; cytoplasm; nucleolus; extracellular region; nucleus; cytosol

Molecular Function: heparin binding; protein binding; growth factor activity; Hsp70 protein binding; receptor binding; fibroblast growth factor receptor binding

Biological Process: fibroblast growth factor receptor signaling pathway; positive regulation of transcription, DNA-dependent; multicellular organismal development; positive regulation of cholesterol biosynthetic process; cardiac muscle cell proliferation; positive regulation of MAP kinase activity; cell proliferation; positive regulation of angiogenesis; induction of an organ; positive regulation of cell division; positive regulation of cell proliferation; positive regulation of transcription from RNA polymerase II promoter; angiogenesis; positive regulation of protein amino acid phosphorylation; cell differentiation; positive regulation of epithelial cell proliferation; positive regulation of cell migration; lung development

Research Articles on FGF1

Similar Products

Product Notes

The FGF1 fgf1 (Catalog #AAA3201772) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Fgf1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's Fgf1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the FGF1 fgf1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MAEGEITTFA ALTERFNLPL GNYKKPKLLY CSNGGHFLRI LPDGTVDGTR. It is sometimes possible for the material contained within the vial of "Fgf1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.