Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot-FGD1 Polyclonal Antibody)

Rabbit anti-Mouse, Rat FGD1 Polyclonal Antibody | anti-FGD1 antibody

FGD1 Polyclonal Antibody

Gene Names
FGD1; AAS; FGDY; MRXS16; ZFYVE3
Reactivity
Mouse, Rat
Applications
Western Blot
Purity
Affinity Purification
Synonyms
FGD1; Polyclonal Antibody; FGD1 Polyclonal Antibody; AAS; FGDY; MRXS16; ZFYVE3; FYVE; RhoGEF and PH domain containing 1; anti-FGD1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
3.77 mg/ml (varies by lot)
Sequence Length
961
Applicable Applications for anti-FGD1 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 700-800 of human FGD1 (NP_004454.2).
Immunogen Sequence
LLNSTNREDEDTPPNSPNVDLGKRAPTPIREKEVTMCMRCQEPFNSITKRRHHCKACGHVVCGKCSEFRARLVYDNNRSNRVCTDCYVALHGVPGSSPACS
Positive Samples
Mouse Brain, Mouse Heart, Rat Brain
Cellular Location
Cell Projection, Cytoplasm, Cytoskeleton, Lamellipodium, Ruffle
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot-FGD1 Polyclonal Antibody)

Western Blot (WB) (Western blot-FGD1 Polyclonal Antibody)
Related Product Information for anti-FGD1 antibody
This gene encodes a protein that contains Dbl (DH) and pleckstrin (PH) homology domains and is similar to the Rho family of small GTP-binding proteins. The encoded protein specifically binds to the Rho family GTPase Cdc42Hs and can stimulate the GDP-GTP exchange of the isoprenylated form of Cdc42Hs. It also stimulates the mitogen activated protein kinase cascade leading to c-Jun kinase SAPK/JNK1 activation. Defects in this gene are the cause of faciogenital dysplasia and X-linked mental retardation, syndromatic 16.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 106kDa
Observed: 110kDa
NCBI Official Full Name
FYVE, RhoGEF and PH domain-containing protein 1
NCBI Official Synonym Full Names
FYVE, RhoGEF and PH domain containing 1
NCBI Official Symbol
FGD1
NCBI Official Synonym Symbols
AAS; FGDY; MRXS16; ZFYVE3
NCBI Protein Information
FYVE, RhoGEF and PH domain-containing protein 1
UniProt Protein Name
FYVE, RhoGEF and PH domain-containing protein 1
UniProt Gene Name
FGD1
UniProt Synonym Gene Names
FGDY; ZFYVE3; Rho/Rac GEF
UniProt Entry Name
FGD1_HUMAN

NCBI Description

This gene encodes a protein that contains Dbl (DH) and pleckstrin (PH) homology domains and is similar to the Rho family of small GTP-binding proteins. The encoded protein specifically binds to the Rho family GTPase Cdc42Hs and can stimulate the GDP-GTP exchange of the isoprenylated form of Cdc42Hs. It also stimulates the mitogen activated protein kinase cascade leading to c-Jun kinase SAPK/JNK1 activation. Defects in this gene are the cause of the faciogenital dysplasia in Aarskog-Scott syndrome and a syndromatic form of X-linked cognitive disability. [provided by RefSeq, Jul 2017]

Research Articles on FGD1

Similar Products

Product Notes

The FGD1 fgd1 (Catalog #AAA9140973) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FGD1 Polyclonal Antibody reacts with Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's FGD1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the FGD1 fgd1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FGD1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.