Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of FERMT3 expression in transfected 293T cell line by FERMT3 polyclonal antibody. Lane 1: FERMT3 transfected lysate (75.4kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human FERMT3 Polyclonal Antibody | anti-FERMT3 antibody

FERMT3 (Fermitin Family Homolog 3, Kindlin-3, MIG2-like Protein, Unc-112-related Protein 2, KIND3, MIG2B, URP2, MGC10966, MIG-2, UNC112C, URP2, URP2SF) (HRP)

Gene Names
FERMT3; URP2; KIND3; MIG-2; MIG2B; URP2SF; UNC112C
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
FERMT3; Polyclonal Antibody; FERMT3 (Fermitin Family Homolog 3; Kindlin-3; MIG2-like Protein; Unc-112-related Protein 2; KIND3; MIG2B; URP2; MGC10966; MIG-2; UNC112C; URP2SF) (HRP); anti-FERMT3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human FERMT3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Horseradish Peroxidase (HRP).
Applicable Applications for anti-FERMT3 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human FERMT3, aa1-663 (NP_113659.3).
Immunogen Sequence
MAGMKTASGDYIDSSWELRVFVGEEDPEAESVTLRVTGESHIGGVLLKIVEQINRKQDWSDHAIWWEQKRQWLLQTHWTLDKYGILADARLFFGPQHRPVILRLPNRRALRLRASFSQPLFQAVAAICRLLSIRHPEELSLLRAPEKKEKKKKEKEPEEELYDLSKVVLAGGVAPALFRGMPAHFSDSAQTEACYHMLSRPQPPPDPLLLQRLPRPSSLSDKTQLHSRWLDSSRCLMQQGIKAGDALWLRFKYYSFFDLDPKTDPVRLTQLYEQARWDLLLEEIDCTEEEMMVFAALQYHINKLSQSGEVGEPAGTDPGLDDLDVALSNLEVKLEGSAPTDVLDSLTTIPELKDHLRIFRPRKLTLKGYRQHWVVFKETTLSYYKSQDEAPGDPIQQLNLKGCEVVPDVNVSGQKFCIKLLVPSPEGMSEIYLRCQDEQQYARWMAGCRLASKGRTMADSSYTSEVQAILAFLSLQRTGSGGPGNHPHGPDASAEGLNPYGLVAPRFQRKFKAKQLTPRILEAHQNVAQLSLAEAQLRFIQAWQSLPDFGISYVMVRFKGSRKDEILGIANNRLIRIDLAVGDVVKTWRFSNMRQWNVNWDIRQVAIEFDEHINVAFSCVSASCRIVHEYIGGYIFLSTRERARGEELDEDLFLQLTGGHEAF
Conjugate
HRP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of FERMT3 expression in transfected 293T cell line by FERMT3 polyclonal antibody. Lane 1: FERMT3 transfected lysate (75.4kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of FERMT3 expression in transfected 293T cell line by FERMT3 polyclonal antibody. Lane 1: FERMT3 transfected lysate (75.4kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-FERMT3 antibody
Plays a central role in cell adhesion in hematopoietic cells. Acts by activating the integrin beta-1-3 (ITGB1, ITGB2 and ITGB3). Required for integrin-mediated platelet adhesion and leukocyte adhesion to endothelial cells. Required for activation of integrin beta-2 (ITGB2) in polymorphonuclear granulocytes (PMNs).
Product Categories/Family for anti-FERMT3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
75,430 Da
NCBI Official Full Name
fermitin family homolog 3 short form
NCBI Official Synonym Full Names
fermitin family member 3
NCBI Official Symbol
FERMT3
NCBI Official Synonym Symbols
URP2; KIND3; MIG-2; MIG2B; URP2SF; UNC112C
NCBI Protein Information
fermitin family homolog 3; kindlin 3; MIG2-like protein; UNC-112 related protein 2; unc-112-related protein 2
UniProt Protein Name
Fermitin family homolog 3
Protein Family
UniProt Gene Name
FERMT3
UniProt Synonym Gene Names
KIND3; MIG2B; URP2
UniProt Entry Name
URP2_HUMAN

NCBI Description

Kindlins are a small family of proteins that mediate protein-protein interactions involved in integrin activation and thereby have a role in cell adhesion, migration, differentiation, and proliferation. The protein encoded by this gene has a key role in the regulation of hemostasis and thrombosis. This protein may also help maintain the membrane skeleton of erythrocytes. Mutations in this gene cause the autosomal recessive leukocyte adhesion deficiency syndrome-III (LAD-III). Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Jan 2010]

Uniprot Description

kindlin-3: Plays a central role in cell adhesion in hematopoietic cells. Acts by activating the integrin beta-1-3 (ITGB1, ITGB2 and ITGB3). Required for integrin-mediated platelet adhesion and leukocyte adhesion to endothelial cells. Required for activation of integrin beta-2 (ITGB2) in polymorphonuclear granulocytes (PMNs). Defects in FERMT3 are the cause of leukocyte adhesion deficiency type 3 (LAD3); also called leukocyte adhesion deficiency 1 variant (LAD1v). LAD3 is a rare syndrome characterized by infections without pus formation in the presence of a leukocytosis combined with a Glanzmann-type bleeding disorder, resulting from a hematopoietic defect in integrin activation. Symptoms arise from an inability to activate the integrins expressed on hematopoietic cells, including platelets and leukocytes. Belongs to the kindlin family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell adhesion

Chromosomal Location of Human Ortholog: 11q13.1

Cellular Component: cell projection; membrane; podosome; cell junction

Molecular Function: integrin binding

Biological Process: integrin activation; integrin-mediated signaling pathway; leukocyte adhesion; regulation of cell-cell adhesion mediated by integrin

Disease: Leukocyte Adhesion Deficiency, Type Iii

Research Articles on FERMT3

Similar Products

Product Notes

The FERMT3 fermt3 (Catalog #AAA6378420) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FERMT3 (Fermitin Family Homolog 3, Kindlin-3, MIG2-like Protein, Unc-112-related Protein 2, KIND3, MIG2B, URP2, MGC10966, MIG-2, UNC112C, URP2, URP2SF) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FERMT3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the FERMT3 fermt3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FERMT3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.