Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-FCRL4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:2500Positive Control: 293T cell lysate)

Rabbit anti-Human, Pig FCRL4 Polyclonal Antibody | anti-FCRL4 antibody

FCRL4 antibody - N-terminal region

Gene Names
FCRL4; FCRH4; IGFP2; IRTA1; CD307d
Reactivity
Human, Pig
Applications
Western Blot
Purity
Affinity Purified
Synonyms
FCRL4; Polyclonal Antibody; FCRL4 antibody - N-terminal region; anti-FCRL4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Pig
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FKGERVTLTCNGFQFYATEKTTWYHRHYWGEKLTLTPGNTLEVRESGLYR
Sequence Length
515
Applicable Applications for anti-FCRL4 antibody
Western Blot (WB)
Homology
Human: 100%; Pig: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human FCRL4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-FCRL4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:2500Positive Control: 293T cell lysate)

Western Blot (WB) (WB Suggested Anti-FCRL4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:2500Positive Control: 293T cell lysate)
Related Product Information for anti-FCRL4 antibody
This is a rabbit polyclonal antibody against FCRL4. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: FCRL4 may function as an inhibitor of the B cell receptor signaling and in the B cell-mediated immune response.
Product Categories/Family for anti-FCRL4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
57kDa
NCBI Official Full Name
Fc receptor-like protein 4
NCBI Official Synonym Full Names
Fc receptor like 4
NCBI Official Symbol
FCRL4
NCBI Official Synonym Symbols
FCRH4; IGFP2; IRTA1; CD307d
NCBI Protein Information
Fc receptor-like protein 4
UniProt Protein Name
Fc receptor-like protein 4
Protein Family
UniProt Gene Name
FCRL4
UniProt Synonym Gene Names
FCRH4; IFGP2; IRTA1
UniProt Entry Name
FCRL4_HUMAN

NCBI Description

This gene encodes a member of the immunoglobulin receptor superfamily and is one of several Fc receptor-like glycoproteins clustered on the long arm of chromosome 1. The encoded protein has four extracellular C2-type immunoglobulin domains, a transmembrane domain and a cytoplasmic domain that contains three immune-receptor tyrosine-based inhibitory motifs. This protein may play a role in the function of memory B-cells in the epithelia. Aberrations in the chromosomal region encoding this gene are associated with non-Hodgkin lymphoma and multiple myeloma. [provided by RefSeq, Apr 2009]

Uniprot Description

FCRL4: May function as an inhibitor of the B-cell receptor signaling. May function in the B-cell-mediated immune response. A chromosomal aberration involving FCRL4 is found in non-Hodgkin lymphoma (NHG). Translocation t(1;1)(p36.3; q21.1-2). A chromosomal aberration involving FCRL4 is found in multiple myeloma (MM). Translocation t(1;14)(q21;q32) that forms a FCRL4-IGHA1 fusion protein. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 1q21

Cellular Component: integral to membrane; plasma membrane

Molecular Function: protein binding

Biological Process: immune system process

Research Articles on FCRL4

Similar Products

Product Notes

The FCRL4 fcrl4 (Catalog #AAA3209739) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FCRL4 antibody - N-terminal region reacts with Human, Pig and may cross-react with other species as described in the data sheet. AAA Biotech's FCRL4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the FCRL4 fcrl4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FKGERVTLTC NGFQFYATEK TTWYHRHYWG EKLTLTPGNT LEVRESGLYR. It is sometimes possible for the material contained within the vial of "FCRL4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.