Western Blot (WB)
(Western Blot analysis of FBXW9 expression in transfected 293T cell line by FBXW9 polyclonal antibody. Lane 1: FBXW9 transfected lysate (14.85kD). Lane 2: Non-transfected lysate.)
Mouse anti-Human FBXW9 Polyclonal Antibody | anti-FBXW9 antibody
FBXW9 (FBW9, F-box/WD Repeat-containing Protein 9, F-box and WD-40 Domain-containing Protein 9, MGC10870)
Reactivity
Human
Applications
Western Blot
Purity
Affinity PurifiedPurified by Protein A affinity chromatography.
Synonyms
FBXW9; Polyclonal Antibody; FBXW9 (FBW9; F-box/WD Repeat-containing Protein 9; F-box and WD-40 Domain-containing Protein 9; MGC10870); Anti -FBXW9 (FBW9; anti-FBXW9 antibody
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human FBXW9.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MTGTSSQAARTTPWWWWTAEPTASCSVCSWTPTCSACPTRNPSSGLVTTRACCTSSPTATAASSLSGPLMWATAFPSLGSSTPWEPCTPHPLTRPSGCTCPQTHQGPFAPEGMTMGSIGSVLRATWWWPALETCR
Applicable Applications for anti-FBXW9 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human FBXW9, aa1-135.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot analysis of FBXW9 expression in transfected 293T cell line by FBXW9 polyclonal antibody. Lane 1: FBXW9 transfected lysate (14.85kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of FBXW9 expression in transfected 293T cell line by FBXW9 polyclonal antibody. Lane 1: FBXW9 transfected lysate (14.85kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-FBXW9 antibody
Members of the F-box protein family, such as FBXW9, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603034), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al., 2004 [PubMed 15520277]).[supplied by OMIM].
Product Categories/Family for anti-FBXW9 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
50,654 Da
NCBI Official Full Name
F-box/WD repeat-containing protein 9
NCBI Official Synonym Full Names
F-box and WD repeat domain containing 9<
NCBI Official Symbol
FBXW9
NCBI Protein Information
F-box/WD repeat-containing protein 9; F-box and WD-40 domain-containing protein 9
UniProt Protein Name
F-box/WD repeat-containing protein 9
Protein Family
UniProt Gene Name
FBXW9
UniProt Entry Name
FBXW9_BOVIN
Uniprot Description
Function: Substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex
By similarity.
Subunit structure: Interacts with SKP1 and CUL1
By similarity.
Sequence similarities: Contains 1 F-box domain.Contains 7 WD repeats.
Similar Products
Product Notes
The FBXW9 fbxw9 (Catalog #AAA6003627) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The FBXW9 (FBW9, F-box/WD Repeat-containing Protein 9, F-box and WD-40 Domain-containing Protein 9, MGC10870) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FBXW9 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the FBXW9 fbxw9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MTGTSSQAAR TTPWWWWTAE PTASCSVCSW TPTCSACPTR NPSSGLVTTR ACCTSSPTAT AASSLSGPLM WATAFPSLGS STPWEPCTPH PLTRPSGCTC PQTHQGPFAP EGMTMGSIGS VLRATWWWPA LETCR. It is sometimes possible for the material contained within the vial of "FBXW9, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
