Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-FBXW10 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Human Muscle)

Rabbit FBXW10 Polyclonal Antibody | anti-FBXW10 antibody

FBXW10 antibody - middle region

Gene Names
FBXW10; HREP; Fbw10; SM25H2; SM2SH2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
FBXW10; Polyclonal Antibody; FBXW10 antibody - middle region; anti-FBXW10 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RKIHLLDIIQVKAIPVEFRGHAGSVRALFLCEEENFLLSGSYDLSIRYWD
Sequence Length
1051
Applicable Applications for anti-FBXW10 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 93%; Guinea Pig: 77%; Horse: 86%; Human: 100%; Mouse: 100%; Rabbit: 86%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human FBXW10
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-FBXW10 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Human Muscle)

Western Blot (WB) (WB Suggested Anti-FBXW10 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Human Muscle)
Related Product Information for anti-FBXW10 antibody
This is a rabbit polyclonal antibody against FBXW10. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Members of the F-box protein family, such as FBXW10, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains. Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests.Members of the F-box protein family, such as FBXW10, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al., 2004 [PubMed 15520277]).[supplied by OMIM].
Product Categories/Family for anti-FBXW10 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
120kDa
NCBI Official Synonym Full Names
F-box and WD repeat domain containing 10
NCBI Official Symbol
FBXW10
NCBI Official Synonym Symbols
HREP; Fbw10; SM25H2; SM2SH2
NCBI Protein Information
F-box/WD repeat-containing protein 10
UniProt Protein Name
F-box/WD repeat-containing protein 10
UniProt Gene Name
FBXW10
UniProt Entry Name
FBW10_HUMAN

NCBI Description

Members of the F-box protein family, such as FBXW10, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al., 2004 [PubMed 15520277]).[supplied by OMIM, Mar 2008]

Research Articles on FBXW10

Similar Products

Product Notes

The FBXW10 fbxw10 (Catalog #AAA3210782) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FBXW10 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's FBXW10 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the FBXW10 fbxw10 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RKIHLLDIIQ VKAIPVEFRG HAGSVRALFL CEEENFLLSG SYDLSIRYWD. It is sometimes possible for the material contained within the vial of "FBXW10, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.