Western Blot (WB)
(Western Blot analysis of FBXO36 expression in transfected 293T cell line by FBXO36 polyclonal antibody. Lane 1: FBXO36 transfected lysate (22.1kD). Lane 2: Non-transfected lysate.)
Rabbit anti-Human FBXO36 Polyclonal Antibody | anti-FBXO36 antibody
FBXO36 (F-box Only Protein 36, FBX36, FLJ37592, FLJ41090) (HRP)
Gene Names
FBXO36; Fbx36
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
FBXO36; Polyclonal Antibody; FBXO36 (F-box Only Protein 36; FBX36; FLJ37592; FLJ41090) (HRP); anti-FBXO36 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human FBXO36.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Horseradish Peroxidase (HRP).
Sequence Length
924
Applicable Applications for anti-FBXO36 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human FBXO36, aa1-188 (AAH33935.1).
Immunogen Sequence
MASWLPETLFETVGQGPPPSKDYYQLLVTRSQVIFRWWKISLRSEYRSTKPGEAKETHEDFLENSHLQGQTALIFGARILDYVINFCKGKFDFLERLSDDLLLTIISYLDLEDIARLCQTSHRFAKLCMSDKLWEQIVQSTCDTITPDVRALAEDTGWRQLFFTNKLQLQRQLRKRKQKYGNLREKQP
Conjugate
HRP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot analysis of FBXO36 expression in transfected 293T cell line by FBXO36 polyclonal antibody. Lane 1: FBXO36 transfected lysate (22.1kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of FBXO36 expression in transfected 293T cell line by FBXO36 polyclonal antibody. Lane 1: FBXO36 transfected lysate (22.1kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-FBXO36 antibody
Substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex.
Product Categories/Family for anti-FBXO36 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Official Full Name
Homo sapiens F-box protein 36, mRNA
NCBI Official Synonym Full Names
F-box protein 36
NCBI Official Symbol
FBXO36
NCBI Official Synonym Symbols
Fbx36
NCBI Protein Information
F-box only protein 36
Protein Family
NCBI Description
Members of the F-box protein family, such as FBXO36, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al., 2004 [PubMed 15520277]).[supplied by OMIM, Mar 2008]
Research Articles on FBXO36
Similar Products
Product Notes
The FBXO36 (Catalog #AAA6378255) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FBXO36 (F-box Only Protein 36, FBX36, FLJ37592, FLJ41090) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FBXO36 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the FBXO36 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FBXO36, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
