Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-FBXL10 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Stomach)

Rabbit FBXL10 Polyclonal Antibody | anti-KDM2B antibody

FBXL10 antibody - middle region

Gene Names
KDM2B; CXXC2; Fbl10; PCCX2; FBXL10; JHDM1B
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
FBXL10; Polyclonal Antibody; FBXL10 antibody - middle region; anti-KDM2B antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LSFFKRCGNICHIDLRYCKQVTKEGCEQFIAEMSVSVQFGQVEEKLLQKL
Sequence Length
1336
Applicable Applications for anti-KDM2B antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human FBXL10
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-FBXL10 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Stomach)

Western Blot (WB) (WB Suggested Anti-FBXL10 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Stomach)
Related Product Information for anti-KDM2B antibody
This is a rabbit polyclonal antibody against FBXL10. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: FBXL10 is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which fun

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
152kDa
NCBI Official Full Name
lysine-specific demethylase 2B isoform a
NCBI Official Synonym Full Names
lysine demethylase 2B
NCBI Official Symbol
KDM2B
NCBI Official Synonym Symbols
CXXC2; Fbl10; PCCX2; FBXL10; JHDM1B
NCBI Protein Information
lysine-specific demethylase 2B
UniProt Protein Name
Lysine-specific demethylase 2B
UniProt Gene Name
KDM2B
UniProt Synonym Gene Names
CXXC2; FBL10; FBXL10; JHDM1B; PCCX2; Protein JEMMA
UniProt Entry Name
KDM2B_HUMAN

NCBI Description

This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbls class. Multiple alternatively spliced transcript variants have been found for this gene, but the full-length nature of some variants has not been determined. [provided by RefSeq, Jul 2008]

Uniprot Description

FBXL10: Histone demethylase that demethylates 'Lys-4' and 'Lys- 36' of histone H3, thereby playing a central role in histone code. Preferentially demethylates trimethylated H3 'Lys-4' and dimethylated H3 'Lys-36' residue while it has weak or no activity for mono- and tri-methylated H3 'Lys-36'. Preferentially binds the transcribed region of ribosomal RNA and represses the transcription of ribosomal RNA genes which inhibits cell growth and proliferation. May also serve as a substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex. Belongs to the JHDM1 histone demethylase family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 1.14.11.27; Oxidoreductase; Nucleolus; Demethylase; DNA-binding

Chromosomal Location of Human Ortholog: 12q24.31

Cellular Component: nucleoplasm; nucleolus; PcG protein complex; nucleus

Molecular Function: rRNA binding; protein binding; histone demethylase activity; DNA binding; zinc ion binding; histone demethylase activity (H3-K36 specific)

Biological Process: midbrain-hindbrain boundary morphogenesis; establishment and/or maintenance of chromatin architecture; transcription, DNA-dependent; fourth ventricle development; negative regulation of transcription from RNA polymerase II promoter; third ventricle development; initiation of neural tube closure; histone demethylation; midbrain development; forebrain development; spermatogenesis; embryonic camera-type eye morphogenesis; negative regulation of neuron apoptosis; lateral ventricle development; hindbrain development

Research Articles on KDM2B

Similar Products

Product Notes

The KDM2B kdm2b (Catalog #AAA3204794) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FBXL10 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's FBXL10 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the KDM2B kdm2b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LSFFKRCGNI CHIDLRYCKQ VTKEGCEQFI AEMSVSVQFG QVEEKLLQKL. It is sometimes possible for the material contained within the vial of "FBXL10, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.