Western Blot (WB)
(Host: RabbitTarget Name: Fbln1Sample Type: Rat Testis lysatesAntibody Dilution: 1.0ug/ml)
Rabbit Fbln1 Polyclonal Antibody | anti-FBLN1 antibody
Fbln1 Antibody - C-terminal region
Reactivity
Tested Species: RatPredicted: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Fbln1; Polyclonal Antibody; Fbln1 Antibody - C-terminal region; anti-FBLN1 antibody
Host
Rabbit
Reactivity
Tested Species: Rat
Predicted: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Predicted: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5 mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: FTRPEEIIFLRAVTPLYPANQADIIFDITEGNLRDSFDIIKRYEDGMTVG
Sequence Length
705
Applicable Applications for anti-FBLN1 antibody
Western Blot (WB)
Predicted Homology Based on Immunogen Sequence
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 77%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Fbln1
Blocking Peptide
For anti-Fbln1 (MBS3206293) antibody is MBS3231259
Protein Size (#AA)
705 amino acids
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: Fbln1Sample Type: Rat Testis lysatesAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: Fbln1Sample Type: Rat Testis lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-FBLN1 antibody
This is a rabbit polyclonal antibody against Fbln1. It was validated on Western Blot
Target Description: The function of this protein remains unknown.
Target Description: The function of this protein remains unknown.
Product Categories/Family for anti-FBLN1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
77kDa
NCBI Official Full Name
fibulin-1
NCBI Official Synonym Full Names
fibulin 1
NCBI Official Symbol
Fbln1
NCBI Protein Information
fibulin-1
UniProt Protein Name
Fibulin-1
UniProt Gene Name
Fbln1
Uniprot Description
Incorporated into fibronectin-containing matrix fibers. May play a role in cell adhesion and migration along protein fibers within the extracellular matrix (ECM). Could be important for certain developmental processes and contribute to the supramolecular organization of ECM architecture, in particular to those of basement membranes.
Research Articles on FBLN1
Similar Products
Product Notes
The FBLN1 fbln1 (Catalog #AAA3206293) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Fbln1 Antibody - C-terminal region reacts with Tested Species: Rat Predicted: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's Fbln1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the FBLN1 fbln1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FTRPEEIIFL RAVTPLYPAN QADIIFDITE GNLRDSFDII KRYEDGMTVG. It is sometimes possible for the material contained within the vial of "Fbln1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
