Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged GJD2 is 0.03 ng/ml as a capture antibody.)

Mouse GJD2 Monoclonal Antibody | anti-GJD2 antibody

GJD2 (Gap Junction Protein, delta 2, 36kD, CX36, GJA9, MGC138315, MGC138319) (PE)

Gene Names
GJD2; CX36; GJA9
Applications
Western Blot
Purity
Purified
Synonyms
GJD2; Monoclonal Antibody; GJD2 (Gap Junction Protein; delta 2; 36kD; CX36; GJA9; MGC138315; MGC138319) (PE); Gap Junction Protein; MGC138319; anti-GJD2 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
500000
Specificity
Recognizes GJD2.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-GJD2 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
GJD2 (NP_065711.1, 99aa-197aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
HQSAKQRERRYSTVFLALDRDPPESIGGPGGTGGGGSGGGKREDKKLQNAIVNGVLQNTENTSKETEPDCLEVKELTPHPSGLRTASKSKLRRQEGISR
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged GJD2 is 0.03 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged GJD2 is 0.03 ng/ml as a capture antibody.)
Related Product Information for anti-GJD2 antibody
Mouse monoclonal antibody raised against a partial recombinant GJD2.
Product Categories/Family for anti-GJD2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36,093 Da
NCBI Official Full Name
gap junction delta-2 protein
NCBI Official Synonym Full Names
gap junction protein, delta 2, 36kDa
NCBI Official Symbol
GJD2
NCBI Official Synonym Symbols
CX36; GJA9
NCBI Protein Information
gap junction delta-2 protein; connexin 36; connexin-36; gap junction alpha-9 protein
UniProt Protein Name
Gap junction delta-2 protein
UniProt Gene Name
GJD2
UniProt Synonym Gene Names
GJA9; Cx36
UniProt Entry Name
CXD2_HUMAN

Uniprot Description

GJD2: One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell. Belongs to the connexin family. Delta-type subfamily.

Protein type: Membrane protein, multi-pass; Cell adhesion; Membrane protein, integral; Channel, misc.

Chromosomal Location of Human Ortholog: 15q14

Cellular Component: connexon complex; plasma membrane; integral to membrane

Molecular Function: gap junction channel activity

Biological Process: synaptic transmission; regulation of action potential; visual perception; transmembrane transport

Similar Products

Product Notes

The GJD2 gjd2 (Catalog #AAA6187764) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's GJD2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GJD2 gjd2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GJD2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.