Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-FASLG AntibodyTitration: 1.0 ug/mlPositive Control: Hela Whole Cell)

Rabbit FASLG Polyclonal Antibody | anti-FASLG antibody

FASLG antibody - middle region

Gene Names
FASLG; APTL; FASL; CD178; CD95L; ALPS1B; CD95-L; TNFSF6; TNLG1A; APT1LG1
Reactivity
Cow, Horse, Human, Pig, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
FASLG; Polyclonal Antibody; FASLG antibody - middle region; anti-FASLG antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Horse, Human, Pig, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVL
Sequence Length
281
Applicable Applications for anti-FASLG antibody
Western Blot (WB)
Homology
Cow: 86%; Horse: 79%; Human: 100%; Pig: 93%; Rabbit: 90%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-FASLG AntibodyTitration: 1.0 ug/mlPositive Control: Hela Whole Cell)

Western Blot (WB) (WB Suggested Anti-FASLG AntibodyTitration: 1.0 ug/mlPositive Control: Hela Whole Cell)
Related Product Information for anti-FASLG antibody
This is a rabbit polyclonal antibody against FASLG. It was validated on Western Blot

Target Description: TNFSF6 is a cytokine that binds to TNFRSF6/FAS, a receptor that transduces the apoptotic signal into cells. May be involved in cytotoxic T cell mediated apoptosis and in T cell development. TNFRSF6/FAS-mediated apoptosis may have a role in the induction of peripheral tolerance, in the antigen-stimulated suicide of mature T cells, or both. Binding to the decoy receptor TNFRSF6B/DcR3 modulates its effects.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
356
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
31kDa
NCBI Official Full Name
tumor necrosis factor ligand superfamily member 6 isoform 1
NCBI Official Synonym Full Names
Fas ligand
NCBI Official Symbol
FASLG
NCBI Official Synonym Symbols
APTL; FASL; CD178; CD95L; ALPS1B; CD95-L; TNFSF6; TNLG1A; APT1LG1
NCBI Protein Information
tumor necrosis factor ligand superfamily member 6
UniProt Protein Name
Tumor necrosis factor ligand superfamily member 6
UniProt Gene Name
FASLG
UniProt Synonym Gene Names
APT1LG1; CD95L; FASL; TNFSF6; APTL; CD95-L; Fas ligand; FasL; sFasL; APL; FasL ICD; SPA
UniProt Entry Name
TNFL6_HUMAN

NCBI Description

This gene is a member of the tumor necrosis factor superfamily. The primary function of the encoded transmembrane protein is the induction of apoptosis triggered by binding to FAS. The FAS/FASLG signaling pathway is essential for immune system regulation, including activation-induced cell death (AICD) of T cells and cytotoxic T lymphocyte induced cell death. It has also been implicated in the progression of several cancers. Defects in this gene may be related to some cases of systemic lupus erythematosus (SLE). Alternatively spliced transcript variants have been described. [provided by RefSeq, Nov 2014]

Uniprot Description

FasL: Cytokine that binds to TNFRSF6/FAS, a receptor that transduces the apoptotic signal into cells. May be involved in cytotoxic T-cell mediated apoptosis and in T-cell development. TNFRSF6/FAS-mediated apoptosis may have a role in the induction of peripheral tolerance, in the antigen-stimulated suicide of mature T-cells, or both. Binding to the decoy receptor TNFRSF6B/DcR3 modulates its effects. Homotrimer (Probable). Interacts with ARHGAP9, BAIAP2L1, BTK, CACNB3, CACNB4, CRK, DLG2, DNMBP, DOCK4, EPS8L3, FGR, FYB, FYN, HCK, ITK, ITSN2, KALRN, LYN, MACC1, MIA, MPP4, MYO15A, NCF1, NCK1, NCK2, NCKIPSD, OSTF1, PIK3R1, PSTPIP1, RIMBP3C, SAMSN1, SH3GL3, SH3PXD2B, SH3PXD2A, SH3RF2, SKAP2, SNX33, SNX9, SORBS3, SPTA1, SRC, SRGAP1, SRGAP2, SRGAP3, TEC, TJP3 and YES1. Belongs to the tumor necrosis factor family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Apoptosis; Membrane protein, integral; Cytokine

Chromosomal Location of Human Ortholog: 1q23

Cellular Component: extracellular space; lysosomal lumen; perinuclear region of cytoplasm; integral to plasma membrane; plasma membrane; extracellular region; caveola; nucleus; external side of plasma membrane

Molecular Function: protein binding; death receptor binding; cytokine activity; tumor necrosis factor receptor binding; receptor binding

Biological Process: caspase activation; positive regulation of I-kappaB kinase/NF-kappaB cascade; transcription, DNA-dependent; apoptosis; positive regulation of apoptosis; response to lipopolysaccharide; negative regulation of transcription from RNA polymerase II promoter; signal transduction; cellular chloride ion homeostasis; endosomal lumen acidification; inflammatory cell apoptosis; negative regulation of angiogenesis; induction of apoptosis via death domain receptors; cell-cell signaling; positive regulation of neuron apoptosis; positive regulation of epidermal growth factor receptor signaling pathway; positive regulation of cell proliferation; immune response; retinal cell programmed cell death

Disease: Lung Cancer; Autoimmune Lymphoproliferative Syndrome

Research Articles on FASLG

Similar Products

Product Notes

The FASLG faslg (Catalog #AAA3200261) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FASLG antibody - middle region reacts with Cow, Horse, Human, Pig, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's FASLG can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the FASLG faslg for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MHTASSLEKQ IGHPSPPPEK KELRKVAHLT GKSNSRSMPL EWEDTYGIVL. It is sometimes possible for the material contained within the vial of "FASLG, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.