Western Blot (WB)
(FAM55D antibody (MBS839246) used at 5 ug/ml to detect target protein.)
Rabbit FAM55D Polyclonal Antibody | anti-FAM55D antibody
FAM55D antibody
Gene Names
NXPE4; FAM55D; C11orf33
Reactivity
Human, Rat, Dog
Applications
Western Blot, Immunohistochemistry
Purity
Total IgG Protein A purified
Synonyms
FAM55D; Polyclonal Antibody; FAM55D antibody; Polyclonal FAM55D; Anti-FAM55D; FAM 55; FAM55; FAM-55; C11orf33; Family With Sequence Similarity 55 Member D; FLJ20127; anti-FAM55D antibody
Host
Rabbit
Reactivity
Human, Rat, Dog
Clonality
Polyclonal
Specificity
FAM55D antibody was raised against the C terminal of FAM55D
Purity/Purification
Total IgG Protein A purified
Form/Format
Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of FAM55D antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
260
Applicable Applications for anti-FAM55D antibody
Western Blot (WB), Immunohistochemistry (IHC)
Application Notes
WB: 5 ug/ml
IHC: 4-8 ug/ml
IHC: 4-8 ug/ml
Biological Significance
The function of FAM55 protein is not widely studied, and is yet to be elucidated fully.
Cross-Reactivity
Human,Rat,Dog
Immunogen
FAM55D antibody was raised using the C terminal of FAM55D corresponding to a region with amino acids TYSVKEMEYLTRAIDRTGGEKNTVIVISLGQHFRPFPIDVFIRRALNVHK
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Western Blot (WB)
(FAM55D antibody (MBS839246) used at 5 ug/ml to detect target protein.)
Western Blot (WB)
(FAM55D antibody (MBS839246) used at 5 ug/ml to detect target protein.)
Related Product Information for anti-FAM55D antibody
Rabbit polyclonal FAM55D antibody raised against the C terminal of FAM55D
Product Categories/Family for anti-FAM55D antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
60 kDa (MW of target protein)
NCBI Official Full Name
family with sequence similarity 55, member D, isoform CRA_b
NCBI Official Synonym Full Names
neurexophilin and PC-esterase domain family, member 4
NCBI Official Symbol
NXPE4
NCBI Official Synonym Symbols
FAM55D; C11orf33
NCBI Protein Information
NXPE family member 4
UniProt Protein Name
NXPE family member 4
UniProt Gene Name
NXPE4
UniProt Synonym Gene Names
C11orf33; FAM55D
UniProt Entry Name
NXPE4_HUMAN
Uniprot Description
FAM55D: Belongs to the NXPE family. 2 isoforms of the human protein are produced by alternative splicing.
Protein type: Secreted; Secreted, signal peptide
Chromosomal Location of Human Ortholog: 11q23.2
Research Articles on FAM55D
Similar Products
Product Notes
The FAM55D nxpe4 (Catalog #AAA839246) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FAM55D antibody reacts with Human, Rat, Dog and may cross-react with other species as described in the data sheet. AAA Biotech's FAM55D can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC). WB: 5 ug/ml IHC: 4-8 ug/ml. Researchers should empirically determine the suitability of the FAM55D nxpe4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FAM55D, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
