Western Blot (WB)
(Host: RabbitTarget Name: FAM40ASample Tissue: Human MCF7 Whole Cell lysatesAntibody Dilution: 3ug/ml)
Rabbit anti-Human FAM40A Polyclonal Antibody | anti-FAM40A antibody
FAM40A Antibody-C-terminal region
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
FAM40A; Polyclonal Antibody; FAM40A Antibody-C-terminal region; Striatin-interacting protein 1; CTTNBP2NL; STRN3; SLMAP; STRN; STK4; STK3; Dlg4; UBC; ZRANB1; SPTAN1; RBM4; EEF1G; EEF1B2; DDX1; DDB1; STRN4; POP1; KHSRP; NUP214; KATNAL2; COLGALT1; Dynll1; MOB4; PPP2R1A; PPP2CB; PPP2CA; FGFR1OP2; PDCD10; STK25; STK24; CTTNBP2; TRAF3IP3; SIKE1; STRIP2; FAR11A; anti-FAM40A antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100ul at 0.5-1mg/ml (varies by lot)
Sequence
YSYTEGPEFLMNRKCFEEDFRIHVTDKKWTELDTNQHRTHAMRLLDGLEV
Applicable Applications for anti-FAM40A antibody
Western Blot (WB)
Protein Size
837 amino acids
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human FAM40A
Predicted Homology Based on Immunogen Sequence
Cow: 100%; Dog: 77%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: FAM40ASample Tissue: Human MCF7 Whole Cell lysatesAntibody Dilution: 3ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: FAM40ASample Tissue: Human MCF7 Whole Cell lysatesAntibody Dilution: 3ug/ml)
Related Product Information for anti-FAM40A antibody
Description of Target: This gene encodes a member of the striatin-interacting phosphatase and kinase complex, which is involved in localization of the Golgi body. The encoded protein participates in cytosketelal organization. Alternative splicing results in multiple transcript variants.
NCBI and Uniprot Product Information
Uniprot Description
STRIP1: Plays a role in the regulation of cell morphology and cytoskeletal organization. Required in the cortical actin filament dynamics and cell shape. Belongs to the FAM40 family. 4 isoforms of the human protein are produced by alternative splicing.
Chromosomal Location of Human Ortholog: 1p13.3
Cellular Component: cytoplasm; nucleus
Molecular Function: protein binding
Biological Process: cortical actin cytoskeleton organization and biogenesis; regulation of cell morphogenesis
Similar Products
Product Notes
The FAM40A strip1 (Catalog #AAA3249668) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FAM40A Antibody-C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FAM40A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the FAM40A strip1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: YSYTEGPEFL MNRKCFEEDF RIHVTDKKWT ELDTNQHRTH AMRLLDGLEV. It is sometimes possible for the material contained within the vial of "FAM40A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
