Western Blot (WB)
(Host: RabbitTarget Name: FAM160A2Sample Type: THP-1 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Rabbit anti-Human FAM160A2 Polyclonal Antibody | anti-FAM160A2 antibody
FAM160A2 Antibody - N-terminal region
Gene Names
FAM160A2; FHIP; C11orf56
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
FAM160A2; Polyclonal Antibody; FAM160A2 Antibody - N-terminal region; anti-FAM160A2 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AVPSAPTGPGPLLEFALHEDLLTRVLTWQLQWDELGDGVEERRAEQLKLF
Sequence Length
972
Applicable Applications for anti-FAM160A2 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human FAM160A2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: FAM160A2Sample Type: THP-1 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: FAM160A2Sample Type: THP-1 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-FAM160A2 antibody
This is a rabbit polyclonal antibody against FAM160A2. It was validated on Western Blot
Target Description: FAM160A2 is a component of the FTS/Hook/FHIP complex (FHF complex). The FHF complex may function to promote vesicle trafficking and/or fusion via the homotypic vesicular protein sorting complex (the HOPS complex).
Target Description: FAM160A2 is a component of the FTS/Hook/FHIP complex (FHF complex). The FHF complex may function to promote vesicle trafficking and/or fusion via the homotypic vesicular protein sorting complex (the HOPS complex).
Product Categories/Family for anti-FAM160A2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
106kDa
NCBI Official Full Name
FTS and Hook-interacting protein isoform 2
NCBI Official Synonym Full Names
family with sequence similarity 160 member A2
NCBI Official Symbol
FAM160A2
NCBI Official Synonym Symbols
FHIP; C11orf56
NCBI Protein Information
FTS and Hook-interacting protein
UniProt Protein Name
FTS and Hook-interacting protein
Protein Family
UniProt Gene Name
FAM160A2
UniProt Synonym Gene Names
C11orf56; KIAA1759; FHIP
UniProt Entry Name
F16A2_HUMAN
NCBI Description
The protein encoded by this gene is part of the FTS/Hook/FHIP (FHF) complex, which can interact with members of the homotypic vesicular protein sorting (HOPS) complex. This interaction suggests that the encoded protein is involved in vesicle trafficking. [provided by RefSeq, Dec 2016]
Similar Products
Product Notes
The FAM160A2 fam160a2 (Catalog #AAA3218461) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FAM160A2 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FAM160A2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the FAM160A2 fam160a2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AVPSAPTGPG PLLEFALHED LLTRVLTWQL QWDELGDGVE ERRAEQLKLF. It is sometimes possible for the material contained within the vial of "FAM160A2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
