Western Blot (WB)
(Host: RabbitTarget Name: ARFIP2Sample Type: THP-1 Whole cell lysatesAntibody Dilution: 1.0ug/ml)
Rabbit ARFIP2 Polyclonal Antibody | anti-ARFIP2 antibody
ARFIP2 Antibody - middle region
Gene Names
ARFIP2; POR1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ARFIP2; Polyclonal Antibody; ARFIP2 Antibody - middle region; anti-ARFIP2 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: CTKQLLSERFGRGSRTVDLELELQIELLRETKRKYESVLQLGRALTAHLY
Sequence Length
256
Applicable Applications for anti-ARFIP2 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 86%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human ARFIP2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: ARFIP2Sample Type: THP-1 Whole cell lysatesAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: ARFIP2Sample Type: THP-1 Whole cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-ARFIP2 antibody
This is a rabbit polyclonal antibody against ARFIP2. It was validated on Western Blot
Target Description: ARFIP2 is a putative target protein of ADP-ribosylation factor. It is involved in membrane ruffling.
Target Description: ARFIP2 is a putative target protein of ADP-ribosylation factor. It is involved in membrane ruffling.
Product Categories/Family for anti-ARFIP2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28kDa
NCBI Official Full Name
arfaptin-2 isoform 3
NCBI Official Synonym Full Names
ADP ribosylation factor interacting protein 2
NCBI Official Symbol
ARFIP2
NCBI Official Synonym Symbols
POR1
NCBI Protein Information
arfaptin-2
UniProt Protein Name
Arfaptin-2
Protein Family
UniProt Gene Name
ARFIP2
UniProt Synonym Gene Names
POR1; Protein POR1
UniProt Entry Name
ARFP2_HUMAN
Uniprot Description
arfaptin 2: Putative target protein of ADP-ribosylation factor. Involved in membrane ruffling. 2 isoforms of the human protein are produced by alternative splicing.
Protein type: Motility/polarity/chemotaxis; GAPs; GAPs, Rac/Rho
Chromosomal Location of Human Ortholog: 11p15
Cellular Component: ruffle; cytoplasm; plasma membrane; trans-Golgi network membrane; cell cortex
Molecular Function: protein domain specific binding; protein binding; GTP binding; GTP-dependent protein binding; Rac GTPase binding
Biological Process: lamellipodium biogenesis; small GTPase mediated signal transduction; ruffle organization and biogenesis; actin cytoskeleton organization and biogenesis; cell motility
Research Articles on ARFIP2
Similar Products
Product Notes
The ARFIP2 arfip2 (Catalog #AAA3211680) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ARFIP2 Antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's ARFIP2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ARFIP2 arfip2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: CTKQLLSERF GRGSRTVDLE LELQIELLRE TKRKYESVLQ LGRALTAHLY. It is sometimes possible for the material contained within the vial of "ARFIP2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
