Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using FAM120A antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)
Rabbit anti-Human FAM120A Polyclonal Antibody | anti-FAM120A antibody
FAM120A Rabbit pAb
Gene Names
FAM120A; OSSA; C9orf10; DNAPTP1; DNAPTP5
Reactivity
Human
Applications
Western Blot
Purity
Affinity purification
Synonyms
FAM120A; Polyclonal Antibody; FAM120A Rabbit pAb; C9orf10; HBVPTPAP; OSSA; DNAPTP1; DNAPTP5; anti-FAM120A antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
MGVQGFQDYIEKHCPSAVVPVELQKLARGSLVGGGRQRPPQTPLRLLVDADNCLHRLYGGFYTDWVSGGQWNHMLGYLAALAKACFGGNIELFVFFNGALEKARLHEWVKRQGNERQTAQQIVSHVQNKGTPPPKVWFLP
Applicable Applications for anti-FAM120A antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human FAM120A (NP_055427.2).
Positive Samples
U-87MG, HeLa
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using FAM120A antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using FAM120A antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)
Product Categories/Family for anti-FAM120A antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
1118
NCBI Official Full Name
Constitutive coactivator of PPAR-gamma-like protein 1
NCBI Official Synonym Full Names
family with sequence similarity 120A
NCBI Official Symbol
FAM120A
NCBI Official Synonym Symbols
OSSA; C9orf10; DNAPTP1; DNAPTP5
NCBI Protein Information
constitutive coactivator of PPAR-gamma-like protein 1; DNA polymerase-transactivated protein 1; DNA polymerase-transactivated protein 5; oxidative stess-associated Src activator; oxidative stress-associated Src activator
UniProt Protein Name
Constitutive coactivator of PPAR-gamma-like protein 1
Protein Family
UniProt Gene Name
FAM120A
UniProt Synonym Gene Names
C9orf10; KIAA0183; OSSA
UniProt Entry Name
F120A_HUMAN
Uniprot Description
FAM120A: May participate in mRNA transport in the cytoplasm. Critical component of the oxidative stress-induced survival signaling. Activates src family kinases and acts as a scaffolding protein enabling src family kinases to phosphorylate and activate PI3-kinase. Binds RNA and promotes the secretion of IGF-II. May play a pivotal role in the progression of scirrhous- type gastric cancer by supporting cancer cell survival in environments with various oxidative stresses. Belongs to the constitutive coactivator of PPAR-gamma family. 5 isoforms of the human protein are produced by alternative splicing.
Protein type: RNA-binding; Tumor suppressor
Chromosomal Location of Human Ortholog: 9q22.31
Cellular Component: membrane; cytoplasm; plasma membrane
Research Articles on FAM120A
Similar Products
Product Notes
The FAM120A fam120a (Catalog #AAA9142913) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FAM120A Rabbit pAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FAM120A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the FAM120A fam120a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MGVQGFQDYI EKHCPSAVVP VELQKLARGS LVGGGRQRPP QTPLRLLVDA DNCLHRLYGG FYTDWVSGGQ WNHMLGYLAA LAKACFGGNI ELFVFFNGAL EKARLHEWVK RQGNERQTAQ QIVSHVQNKG TPPPKVWFLP. It is sometimes possible for the material contained within the vial of "FAM120A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
