Western Blot (WB)
(Host: RabbitTarget Name: FAIM2Sample Type: HepG2 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Rabbit FAIM2 Polyclonal Antibody | anti-FAIM2 antibody
FAIM2 Antibody - N-terminal region
Gene Names
FAIM2; LFG; LFG2; NGP35; NMP35; TMBIM2
Reactivity
Cow, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
FAIM2; Polyclonal Antibody; FAIM2 Antibody - N-terminal region; anti-FAIM2 antibody
Host
Rabbit
Reactivity
Cow, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QVHGEKKEAPAVPSAPPSYEEATSGEGMKAGAFPPAPTAVPLHPSWAYVD
Sequence Length
208
Applicable Applications for anti-FAIM2 antibody
Western Blot (WB)
Homology
Cow: 79%; Horse: 79%; Human: 100%; Mouse: 79%; Pig: 86%; Rabbit: 79%; Rat: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of human FAIM2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: FAIM2Sample Type: HepG2 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: FAIM2Sample Type: HepG2 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-FAIM2 antibody
This is a rabbit polyclonal antibody against FAIM2. It was validated on Western Blot
Product Categories/Family for anti-FAIM2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22kDa
NCBI Official Full Name
protein lifeguard 2
NCBI Official Synonym Full Names
Fas apoptotic inhibitory molecule 2
NCBI Official Symbol
FAIM2
NCBI Official Synonym Symbols
LFG; LFG2; NGP35; NMP35; TMBIM2
NCBI Protein Information
protein lifeguard 2
UniProt Protein Name
Protein lifeguard 2
Protein Family
UniProt Gene Name
FAIM2
UniProt Synonym Gene Names
KIAA0950; LFG; LFG2; NMP35; TMBIM2
UniProt Entry Name
LFG2_HUMAN
Uniprot Description
FAIM2: Antiapoptotic protein which protects cells uniquely from Fas-induced apoptosis. Regulates Fas-mediated apoptosis in neurons by interfering with caspase-8 activation. May play a role in cerebellar development by affecting cerebellar size, internal granular layer (IGL) thickness, and Purkinje cell (PC) development. Belongs to the BI1 family. LFG subfamily.
Protein type: Membrane protein, integral; Membrane protein, multi-pass; Apoptosis
Chromosomal Location of Human Ortholog: 12q13
Cellular Component: postsynaptic membrane; integral to membrane; cell junction; lipid raft
Biological Process: apoptosis; cerebellar granular layer development; regulation of neuron apoptosis; cerebellar Purkinje cell differentiation; cerebellar Purkinje cell layer development; cerebellum development; negative regulation of neuron apoptosis; negative regulation of apoptosis
Research Articles on FAIM2
Similar Products
Product Notes
The FAIM2 faim2 (Catalog #AAA3216673) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FAIM2 Antibody - N-terminal region reacts with Cow, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's FAIM2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the FAIM2 faim2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QVHGEKKEAP AVPSAPPSYE EATSGEGMKA GAFPPAPTAV PLHPSWAYVD. It is sometimes possible for the material contained within the vial of "FAIM2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
