Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: FADS1Sample Tissue: Human 786-0 Whole CellAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human FADS1 Polyclonal Antibody | anti-FADS1 antibody

FADS1 Antibody - middle region

Gene Names
FADS1; D5D; TU12; FADS6; FADSD5; LLCDL1
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
FADS1; Polyclonal Antibody; FADS1 Antibody - middle region; anti-FADS1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: INKGLVKKYMNSLLIGELSPEQPSFEPTKNKELTDEFRELRATVERMGLM
Sequence Length
167
Applicable Applications for anti-FADS1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human FADS1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: FADS1Sample Tissue: Human 786-0 Whole CellAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: FADS1Sample Tissue: Human 786-0 Whole CellAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-FADS1 antibody
The protein encoded by this gene is a member of the fatty acid desaturase (FADS) gene family. Desaturase enzymes regulate unsaturation of fatty acids through the introduction of double bonds between defined carbons of the fatty acyl chain. FADS family members are considered fusion products composed of an N-terminal cytochrome b5-like domain and a C-terminal multiple membrane-spanning desaturase portion, both of which are characterized by conserved histidine motifs. This gene is clustered with family members FADS1 and FADS2 at 11q12-q13.1; this cluster is thought to have arisen evolutionarily from gene duplication based on its similar exon/intron organization.
Product Categories/Family for anti-FADS1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52 kDa
NCBI Official Full Name
fatty acid desaturase 1
NCBI Official Synonym Full Names
fatty acid desaturase 1
NCBI Official Symbol
FADS1
NCBI Official Synonym Symbols
D5D; TU12; FADS6; FADSD5; LLCDL1
NCBI Protein Information
acyl-CoA (8-3)-desaturase; fatty acid desaturase 1
UniProt Protein Name
Fatty acid desaturase 1
Protein Family
UniProt Gene Name
FADS1
UniProt Synonym Gene Names
FADSD5; D5D; Delta(5) desaturase; Delta-5 desaturase
UniProt Entry Name
FADS1_HUMAN

NCBI Description

The protein encoded by this gene is a member of the fatty acid desaturase (FADS) gene family. Desaturase enzymes regulate unsaturation of fatty acids through the introduction of double bonds between defined carbons of the fatty acyl chain. FADS family members are considered fusion products composed of an N-terminal cytochrome b5-like domain and a C-terminal multiple membrane-spanning desaturase portion, both of which are characterized by conserved histidine motifs. This gene is clustered with family members FADS1 and FADS2 at 11q12-q13.1; this cluster is thought to have arisen evolutionarily from gene duplication based on its similar exon/intron organization. [provided by RefSeq, Jul 2008]

Uniprot Description

FADS1: Component of a lipid metabolic pathway that catalyzes biosynthesis of highly unsaturated fatty acids (HUFA) from precursor essential polyunsaturated fatty acids (PUFA) linoleic acid (LA) (18:2n-6) and alpha-linolenic acid (ALA) (18:3n-3). Catalyzes the desaturation of dihomo-gamma-linoleic acid (DHGLA) (20:3n-6) and eicosatetraenoic acid (20:4n-3) to generate arachidonic acid (AA) (20:4n-6) and eicosapentaenoic acid (EPA)(20:5n-3) respectively. Belongs to the fatty acid desaturase family.

Protein type: EC 1.14.19.-; Membrane protein, multi-pass; Oxidoreductase; Lipid Metabolism - unsaturated fatty acid biosynthesis; Membrane protein, integral

Chromosomal Location of Human Ortholog: 11q12.2-q13.1

Cellular Component: endoplasmic reticulum membrane; intracellular membrane-bound organelle; mitochondrion; membrane; integral to membrane

Molecular Function: C-5 sterol desaturase activity; iron ion binding; heme binding; oxidoreductase activity

Biological Process: icosanoid biosynthetic process; regulation of transcription, DNA-dependent; cell-cell signaling; regulation of cell differentiation; unsaturated fatty acid metabolic process; linoleic acid metabolic process; unsaturated fatty acid biosynthetic process; cellular lipid metabolic process; cellular response to starvation; phospholipid biosynthetic process

Research Articles on FADS1

Similar Products

Product Notes

The FADS1 fads1 (Catalog #AAA3220324) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FADS1 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FADS1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the FADS1 fads1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: INKGLVKKYM NSLLIGELSP EQPSFEPTKN KELTDEFREL RATVERMGLM. It is sometimes possible for the material contained within the vial of "FADS1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.