Rabbit anti-Human FABP7 Polyclonal Antibody | anti-FABP7 antibody

FABP7 (Fatty Acid-binding Protein, Brain, Brain Lipid-binding Protein, BLBP, Brain-type Fatty Acid-binding Protein, B-FABP, Fatty Acid-binding Protein 7, Mammary-derived Growth Inhibitor Related, BLBP, FABPB, MRG) (Biotin)

Cat. Num. AAA6377923

• Gene Names: FABP7; MRG; BLBP; FABPB; B-FABP; LTR2-FABP7
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: FABP7; Polyclonal Antibody; FABP7 (Fatty Acid-binding Protein; Brain; Brain Lipid-binding Protein; BLBP; Brain-type Fatty Acid-binding Protein; B-FABP; Fatty Acid-binding Protein 7; Mammary-derived Growth Inhibitor Related; FABPB; MRG) (Biotin); anti-FABP7 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human FABP7.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-FABP7 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human FABP7, aa1-132 (NP_001437.1).
• Immunogen Sequence: MVEAFCATWKLTNSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKNTEISFQLGEEFDETTADDRNCKSVVSLDGDKLVHIQKWDGKETNFVREIKDGKMVMTLTFGDVVAVRHYEKA
• Conjugate: Biotin
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of FABP7 expression in transfected 293T cell line by FABP7 polyclonal antibody. Lane 1: FABP7 transfected lysate (14.9kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-FABP7 antibody

FABP7 (Fatty acid binding protein 7) is also known as brain fatty acid-binding protein (B-FABP) and is a member of fatty acid-binding proteins (FABPs) which are a family of small, highly conserved, cytoplasmic proteins to bind long-chain fatty acids and other hydrophobic ligands. FABP7 is expressed in radial glia by the activation of Notch receptors and binds DHA with the highest affinity among all of FABPs.

Product Categories/Family for anti-FABP7 antibody

Antibodies; Binding Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 4557585
• NCBI GeneID: 2173
• NCBI Accession #: NP_001437.1
• NCBI GenBank Nucleotide #: NM_001446
• UniProt Accession #: O15540; O14951; Q6IAU7; Q9H047; B2R4L1
• Molecular Weight: 18,829 Da
• NCBI Official Full Name: fatty acid-binding protein, brain
• NCBI Official Synonym Full Names: fatty acid binding protein 7, brain
• NCBI Official Symbol: FABP7
• NCBI Official Synonym Symbols: MRG; BLBP; FABPB; B-FABP; LTR2-FABP7
• NCBI Protein Information: fatty acid-binding protein, brain; Hypothetical protein DKFZp547J2313; brain lipid binding protein; brain lipid-binding protein; brain-type fatty acid-binding protein; fatty acid-binding protein 7; mammary-derived growth inhibitor related; mammary-derived
• UniProt Protein Name: Fatty acid-binding protein, brain
• Protein Family: Fatty acid-binding protein
• UniProt Gene Name: FABP7
• UniProt Synonym Gene Names: BLBP; FABPB; MRG; BLBP; B-FABP
• UniProt Entry Name: FABP7_HUMAN

NCBI Description

The protein encoded by this gene is a brain fatty acid binding protein. Fatty acid binding proteins (FABPs) are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. FABPs are thought to play roles in fatty acid uptake, transport, and metabolism. [provided by RefSeq, Jul 2008]

Uniprot Description

FABP7: B-FABP could be involved in the transport of a so far unknown hydrophobic ligand with potential morphogenic activity during CNS development. It is required for the establishment of the radial glial fiber system in developing brain, a system that is necessary for the migration of immature neurons to establish cortical layers. Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family.

Protein type: Cell development/differentiation; Lipid-binding; Cell cycle regulation

Chromosomal Location of Human Ortholog: 6q22-q23

Cellular Component: cell projection; cell soma; cytoplasm; nucleus

Molecular Function: transporter activity; lipid binding

Biological Process: negative regulation of cell proliferation; nervous system development; epithelial cell proliferation; prepulse inhibition; neurogenesis; transport; cell proliferation in forebrain