Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-F2R Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Hela cell lysateF2R is supported by BioGPS gene expression data to be expressed in HeLa)

Rabbit F2R Polyclonal Antibody | anti-F2R antibody

F2R antibody - N-terminal region

Gene Names
F2R; TR; HTR; CF2R; PAR1; PAR-1
Reactivity
Guinea Pig, Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
F2R; Polyclonal Antibody; F2R antibody - N-terminal region; anti-F2R antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Guinea Pig, Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KYEPFWEDEEKNESGLTEYRLVSINKSSPLQKQLPAFISEDASGYLTSSW
Sequence Length
425
Applicable Applications for anti-F2R antibody
Western Blot (WB)
Homology
Guinea Pig: 78%; Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human F2R
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-F2R Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Hela cell lysateF2R is supported by BioGPS gene expression data to be expressed in HeLa)

Western Blot (WB) (WB Suggested Anti-F2R Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Hela cell lysateF2R is supported by BioGPS gene expression data to be expressed in HeLa)
Related Product Information for anti-F2R antibody
This is a rabbit polyclonal antibody against F2R. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Coagulation factor II receptor(F2R) is a 7-transmembrane receptor involved in the regulation of thrombotic response. Proteolytic cleavage leads to the activation of the receptor. F2R is a G-protein coupled receptor family member.Coagulation factor II receptor is a 7-transmembrane receptor involved in the regulation of thrombotic response. Proteolytic cleavage leads to the activation of the receptor. F2R is a G-protein coupled receptor family member. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47kDa
NCBI Official Full Name
proteinase-activated receptor 1 isoform 1
NCBI Official Synonym Full Names
coagulation factor II thrombin receptor
NCBI Official Symbol
F2R
NCBI Official Synonym Symbols
TR; HTR; CF2R; PAR1; PAR-1
NCBI Protein Information
proteinase-activated receptor 1
UniProt Protein Name
Proteinase-activated receptor 1
UniProt Gene Name
F2R
UniProt Synonym Gene Names
CF2R; PAR1; TR; PAR-1
UniProt Entry Name
PAR1_HUMAN

NCBI Description

Coagulation factor II receptor is a 7-transmembrane receptor involved in the regulation of thrombotic response. Proteolytic cleavage leads to the activation of the receptor. F2R is a G-protein coupled receptor family member. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2015]

Uniprot Description

PAR1: a G-protein coupled high-affinity receptor for activated thrombin or trypsin. Coupled to G proteins that stimulate phosphoinositide hydrolysis. Coupled to G proteins that stimulate phosphoinositide hydrolysis. May play a role in platelet activation and in vascular development.

Protein type: Membrane protein, integral; Membrane protein, multi-pass; GPCR, family 1; Receptor, GPCR; Cell development/differentiation

Chromosomal Location of Human Ortholog: 5q13

Cellular Component: Golgi apparatus; postsynaptic membrane; integral to plasma membrane; early endosome; extracellular region; plasma membrane; caveola; neuromuscular junction

Molecular Function: G-protein coupled receptor activity; protein binding; G-protein alpha-subunit binding; G-protein beta-subunit binding; receptor binding; thrombin receptor activity

Biological Process: elevation of cytosolic calcium ion concentration during G-protein signaling, coupled to IP3 second messenger (phospholipase C activating); positive regulation of blood coagulation; negative regulation of glomerular filtration; activation of MAPKK activity; positive regulation of transcription, DNA-dependent; positive regulation of collagen biosynthetic process; positive regulation of caspase activity; positive regulation of JAK-STAT cascade; response to lipopolysaccharide; negative regulation of cell proliferation; connective tissue replacement during inflammatory response; elevation of cytosolic calcium ion concentration; platelet dense granule organization and biogenesis; positive regulation of MAPKKK cascade; regulation of interleukin-1 beta production; protein kinase C activation; positive regulation of cell proliferation; response to wounding; negative regulation of neuron apoptosis; positive regulation of smooth muscle contraction; establishment of synaptic specificity at neuromuscular junction; inflammatory response; STAT protein nuclear translocation; caspase activation; platelet activation; anatomical structure morphogenesis; positive regulation of I-kappaB kinase/NF-kappaB cascade; positive regulation of Rho protein signal transduction; positive regulation of phosphoinositide 3-kinase cascade; tyrosine phosphorylation of STAT protein; G-protein coupled receptor protein signaling pathway; homeostasis of number of cells within a tissue; release of sequestered calcium ion into cytosol; regulation of blood coagulation; positive regulation of vasoconstriction; G-protein signaling, coupled to IP3 second messenger (phospholipase C activating); positive regulation of release of sequestered calcium ion into cytosol; regulation of sensory perception of pain; positive regulation of calcium ion transport; blood coagulation; positive regulation of cell migration

Research Articles on F2R

Similar Products

Product Notes

The F2R f2r (Catalog #AAA3210410) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The F2R antibody - N-terminal region reacts with Guinea Pig, Human and may cross-react with other species as described in the data sheet. AAA Biotech's F2R can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the F2R f2r for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KYEPFWEDEE KNESGLTEYR LVSINKSSPL QKQLPAFISE DASGYLTSSW. It is sometimes possible for the material contained within the vial of "F2R, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.