Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-F11R AntibodyTitration: 1.0 ug/mlPositive Control: 721_B Whole Cell)

Rabbit F11R Polyclonal Antibody | anti-F11R antibody

F11R antibody - C-terminal region

Gene Names
F11R; JAM; KAT; JAM1; JAMA; JCAM; CD321; PAM-1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
F11R; Polyclonal Antibody; F11R antibody - C-terminal region; anti-F11R antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SNSSYVLNPTTGELVFDPLSASDTGEYSCEARNGYGTPMTSNAVRMEAVE
Sequence Length
299
Applicable Applications for anti-F11R antibody
Western Blot (WB)
Homology
Cow: 91%; Dog: 91%; Guinea Pig: 82%; Horse: 91%; Human: 100%; Mouse: 90%; Pig: 91%; Rabbit: 91%; Rat: 100%; Zebrafish: 90%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-F11R AntibodyTitration: 1.0 ug/mlPositive Control: 721_B Whole Cell)

Western Blot (WB) (WB Suggested Anti-F11R AntibodyTitration: 1.0 ug/mlPositive Control: 721_B Whole Cell)
Related Product Information for anti-F11R antibody
This is a rabbit polyclonal antibody against F11R. It was validated on Western Blot

Target Description: Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. The protein encoded by this immunoglobulin superfamily gene member is an important regulator of tight junction assembly in epithelia. In addition, the encoded protein can act as (1) a receptor for reovirus, (2) a ligand for the integrin LFA1, involved in leukocyte transmigration, and (3) a platelet receptor. Multiple 5' alternatively spliced variants, encoding the same protein, have been identified but their biological validity has not been established.
Product Categories/Family for anti-F11R antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33kDa
NCBI Official Full Name
junctional adhesion molecule A isoform 1
NCBI Official Synonym Full Names
F11 receptor
NCBI Official Symbol
F11R
NCBI Official Synonym Symbols
JAM; KAT; JAM1; JAMA; JCAM; CD321; PAM-1
NCBI Protein Information
junctional adhesion molecule A
UniProt Protein Name
Junctional adhesion molecule A
UniProt Gene Name
F11R
UniProt Synonym Gene Names
JAM1; JCAM; JAM-A; JAM-1; PAM-1
UniProt Entry Name
JAM1_HUMAN

NCBI Description

Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. The protein encoded by this immunoglobulin superfamily gene member is an important regulator of tight junction assembly in epithelia. In addition, the encoded protein can act as (1) a receptor for reovirus, (2) a ligand for the integrin LFA1, involved in leukocyte transmigration, and (3) a platelet receptor. Multiple 5' alternatively spliced variants, encoding the same protein, have been identified but their biological validity has not been established. [provided by RefSeq, Jul 2008]

Uniprot Description

JAM-A: Seems to play a role in epithelial tight junction formation. Appears early in primordial forms of cell junctions and recruits PARD3. The association of the PARD6-PARD3 complex may prevent the interaction of PARD3 with JAM1, thereby preventing tight junction assembly. Plays a role in regulating monocyte transmigration involved in integrity of epithelial barrier. Involved in platelet activation. In case of orthoreovirus infection, serves as receptor for the virus. Belongs to the immunoglobulin superfamily.

Protein type: Membrane protein, integral; Cell adhesion

Chromosomal Location of Human Ortholog: 1q21.2-q21.3

Cellular Component: microtubule cytoskeleton; tight junction; integral to membrane; plasma membrane; intercellular junction; cytoplasmic vesicle; cell junction

Molecular Function: protein binding; PDZ domain binding

Biological Process: intercellular junction assembly and maintenance; response to radiation; extracellular matrix organization and biogenesis; viral reproduction; transforming growth factor beta receptor signaling pathway; actomyosin structure organization and biogenesis; inflammatory response; cell adhesion; blood coagulation; leukocyte migration; positive regulation of blood pressure; intestinal absorption

Research Articles on F11R

Similar Products

Product Notes

The F11R f11r (Catalog #AAA3215199) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The F11R antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's F11R can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the F11R f11r for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SNSSYVLNPT TGELVFDPLS ASDTGEYSCE ARNGYGTPMT SNAVRMEAVE. It is sometimes possible for the material contained within the vial of "F11R, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.